KEGG   Rummeliibacillus stabekisii: ATY39_09080Help
Entry
ATY39_09080       CDS       T04369                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00010  Glycolysis / Gluconeogenesis
rst00030  Pentose phosphate pathway
rst00051  Fructose and mannose metabolism
rst00052  Galactose metabolism
rst00680  Methane metabolism
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01120  Microbial metabolism in diverse environments
rst01130  Biosynthesis of antibiotics
rst01200  Carbon metabolism
rst01230  Biosynthesis of amino acids
rst03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATY39_09080
   00030 Pentose phosphate pathway
    ATY39_09080
   00051 Fructose and mannose metabolism
    ATY39_09080
   00052 Galactose metabolism
    ATY39_09080
  09102 Energy metabolism
   00680 Methane metabolism
    ATY39_09080
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ATY39_09080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rst01009]
    ATY39_09080
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:rst03019]
    ATY39_09080
Enzymes [BR:rst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATY39_09080
Protein phosphatases and associated proteins [BR:rst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ATY39_09080
Messenger RNA biogenesis [BR:rst03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ATY39_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat PucR NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AMW99598
UniProt: A0A143HCW1
LinkDB All DBs
Position
complement(1839872..1840831)
Genome map
AA seq 319 aa AA seqDB search
MKKIGVLTSGGDAPGMNAAVRAVVRKAIFHGMEVAGIYHGYQGLINGNIENLDVGDVGDI
IQRGGTMLHSARCLEFKTEEGQRKAISQLKEHGIEGLVVIGGDGSYRGALALSKLGFPSV
GVPGTIDNDIPGTDYTIGFDTALNTIIESIDKIRDTATSHERSFIIEVMGRDAGDLALWA
GLAGGAETILIPEVPSDIDGLVRRLEQGYERGKKHSIIIVAEGVMSAGELATLLKEKADI
ETRVSVLGHIQRGGSPTGRDRVLASQLGAKAVEVLMEDRGGVAIGIRNHQVVDYELSEAF
NKAHKAELSMYTLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtgtgttaacaagcggtggagatgcgcctggtatgaatgcagctgtt
cgggcagttgtcagaaaagcaatttttcacggcatggaagtcgcgggcatttatcacggc
tatcaaggattaatcaatggtaatattgaaaatctagacgtaggtgatgtaggtgatatc
atccagcggggtggcacgatgctacattctgccagatgtctagaatttaaaacagaagaa
gggcaaagaaaagcaatcagccagcttaaagagcatggcatcgagggcttagtcgttatc
ggcggagatggttcttatcgaggagccttggctttgagcaaattaggtttccctagcgta
ggtgtaccaggaacgattgataatgatattcctggcactgattacaccatcggttttgat
acagctttaaataccattattgaaagcatagacaaaatcagggatacagcaacttcccat
gagcgctcgttcattattgaagtaatgggacgcgatgcaggtgacttagcattatgggct
ggccttgctggcggtgctgaaactatccttattccagaagttccatcagatattgatgga
cttgtcagacgcttagagcaaggatatgaacgtggcaaaaaacatagtattattatcgtc
gcagaaggtgttatgtctgcaggcgagttagctacactattaaaagaaaaagcggatata
gaaacaagagtatcagtattggggcatattcaacgcggtggttcgccgacgggtcgcgat
cgtgtattagctagccaactcggtgcaaaggcagtggaagttttaatggaagaccgaggt
ggagtggcaattggcattcgtaaccatcaggtggtagactatgaattgagtgaagcgttt
aataaagcacataaagcggaattatctatgtataccctttcgcaagaactatcgatctaa

DBGET integrated database retrieval system