KEGG   Rummeliibacillus stabekisii: ATY39_09770Help
Entry
ATY39_09770       CDS       T04369                                 

Definition
(GenBank) peptidylprolyl isomerase
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
rst  Rummeliibacillus stabekisii
Brite
KEGG Orthology (KO) [BR:rst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rst03110]
    ATY39_09770
Enzymes [BR:rst01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ATY39_09770
Chaperones and folding catalysts [BR:rst03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    ATY39_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: AMX01064
UniProt: A0A143HH58
LinkDB All DBs
Position
complement(1966725..1967315)
Genome map
AA seq 196 aa AA seqDB search
MYPQLSNEVADNEVLVEMNTNQGSVKIKLFPELAPKTVENFLTHAKNGYYEGIIFHRVIK
DFMIQGGDPTGTGMGGESIYGSSFEDEFNPELMNIRGALSMANAGPNTNGSQFFIVHMSE
VPANMIGQMQDAGFPEEVIQAYKERGGTPWLDGKHTVFGQVVEGMDIVDKIADAKVGFQD
KPVEDIVIQSIKVVEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgtacccacagttgtcaaatgaagtagctgacaatgaagtattagttgaaatgaacacg
aaccaaggcagcgttaaaatcaaattattccctgagttggcgcctaaaacagttgaaaac
ttcttaacacacgctaaaaatggttactacgaaggaatcattttccaccgtgtcattaaa
gatttcatgattcaaggtggagacccaactggtacaggtatgggtggagaaagtatttat
ggtagctcatttgaagatgaatttaaccctgaattaatgaatattcgcggtgcgctttct
atggccaatgctggtccaaatacaaacggcagccaattctttatcgtgcacatgtctgaa
gtgccagcaaatatgattggccaaatgcaagatgctggattcccagaagaagtaatccaa
gcttataaagagcgcggaggcactccatggttagacggcaagcacactgtgtttggacaa
gttgtagaaggcatggatatcgtcgataaaattgcagatgcaaaagtaggcttccaagac
aagccagtagaagatattgtcatccaatcaattaaagtagtcgaaaaataa

DBGET integrated database retrieval system