KEGG   Rhodovulum sulfidophilum: NHU_00722Help
Entry
NHU_00722         CDS       T04143                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
rsu  Rhodovulum sulfidophilum
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NHU_00722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: BAQ67890
UniProt: A0A0D6AZ28
LinkDB All DBs
Position
720707..721462
Genome map
AA seq 251 aa AA seqDB search
MIDFGPFFFAVAIPAILFAGVSKGGFGGGVAFAGSAVMVVILGPAVALGVTLPLLMLMDV
TALRPYWRRWDGASARVLILGAVPGIALAAAVFHLTDPDVFRVLIGLVALGFVGFQLAVR
LKLIPARQRPFGRRAGAISGAVAGFTSFVSHAGGPPVAVYLLSQRLDKTSFQATTVLVFW
AINLLKFGPYAFLGIFTADTWLAVLLLAPVAVLGVWLGVRAHRLVPERWFFGITYAALAL
TGAKLLWDGLS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttcggcccgttcttcttcgccgtggcgatcccggcgatcctgttcgcaggt
gtgtccaaaggcggcttcggcggcggcgtggcctttgcgggctcggcggtgatggtggtg
attctgggcccggcggtggcgctgggggtgacgctgccgcttctgatgctgatggatgtg
accgcgctccggccctattggcggcgctgggacggggcatcggcgcgggtgctgatcctt
ggcgcggtgcccggcatcgcgctggcggcggcggtgttccatctgaccgatccggacgtg
ttccgggtgctgatcgggctggtggcgctgggcttcgtcggcttccagcttgccgtgcgg
ctgaagctgatcccggcgcgccagcgccccttcggtcggcgcgcgggcgcgatctcgggt
gcggtggccggcttcaccagcttcgtcagccatgccggagggccgccggtcgccgtctac
ctgctgtcgcagcggctggacaagaccagctttcaggcgaccacggtgctggtcttctgg
gcgatcaacctgctgaaattcggcccctatgcctttctcggcatcttcaccgccgatacc
tggctggcggtgctgctgctggcgccggtcgcggtccttggcgtctggctgggggtgcgg
gcgcaccggctggtgccggagcgctggttcttcggcatcacctatgccgcgcttgcgctg
accggggccaagcttctgtgggacgggctgagctga

DBGET integrated database retrieval system