KEGG   Rhodovulum sulfidophilum: NHU_01482Help
Entry
NHU_01482         CDS       T04143                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
Organism
rsu  Rhodovulum sulfidophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAQ68640
UniProt: A0A0D6B183
LinkDB All DBs
Position
complement(1553987..1554934)
Genome map
AA seq 315 aa AA seqDB search
MTDTPLLICGAAFTEDERARLSTAVSSVSVDGPAALEALAPGLRERLRVVAYKGQTPFGA
REMAALPGLGLIANFGVGYDAIDLAAATARDIRVTNTPDVLNDDVADMAVGLILAQARCL
LRGDGWVRSGRWGKYGEMPLARKVSGARAGIVGLGRIGREIADRLAAFKMEIHYHSRQQK
ETPGWRYHADPVSLAGAVDFLVVALVGGEETRNYVSAEAIAALGPTGVLINISRGTTVDE
GALLAALEQRRIAGAGLDVYLDEPAIDPRFQGLDNVVLQPHAGSATVETRRAMAELQLAN
IRAFLDGEPLPSPVN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccccctgctgatctgcggcgccgccttcaccgaggacgagcgcgcccga
ctgtcaactgcggtctcctccgtctcggtcgatggacccgccgcgctcgaagcgctcgcc
cccggcctgcgcgagcgacttcgcgtcgtcgcctacaaggggcagaccccattcggcgcg
cgtgagatggccgcgctgcccgggctggggctgatcgccaatttcggtgtcggatacgat
gccatcgaccttgccgccgccaccgcgcgcgacatccgcgtcaccaacacacccgacgtt
ctgaacgacgatgtcgccgatatggcggtggggctgatcctcgcgcaggcgcgctgtctt
ctgcgcggcgacggctgggtccggagcggccgctggggcaaatacggcgagatgccgctt
gcccggaaggtgtcgggcgcgcgggccggaattgtcgggctgggccggatcgggcgcgag
atcgccgaccggcttgccgccttcaagatggagatccactaccattcgcggcaacagaag
gagacccccggctggcgctatcacgccgatccggtcagccttgccggcgcggtcgatttc
ctcgtcgtggcgctggtcggcggcgaggagaccaggaattacgtctccgccgaggcgatt
gccgcgctcgggccgacgggtgtcctgatcaacatctcgcgcggcacgacggtcgacgag
ggggcgctgcttgccgcgctggaacagcgccggatcgcgggcgccgggcttgacgtctat
ctcgacgagcccgccatcgacccgcgctttcaggggctcgacaatgtggtgctgcaaccg
catgcgggctcggccaccgtcgagacccggcgcgccatggccgaactgcaactggccaat
atccgtgcctttctggatggcgagccgctcccgagccccgtcaactaa

DBGET integrated database retrieval system