KEGG   Rhodovulum sulfidophilum: NHU_02604Help
Entry
NHU_02604         CDS       T04143                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00500  Starch and sucrose metabolism
rsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NHU_02604
Enzymes [BR:rsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NHU_02604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: BAQ69752
UniProt: A0A0D6B3U5
LinkDB All DBs
Position
complement(2724897..2726117)
Genome map
AA seq 406 aa AA seqDB search
MRRAVSATGLSRHRAGFGWTVVPAPGSILASTRVASWDPEPDYFHHWTRDAAIALAAIPA
AMAAEPEAAAFWRQAVVDHIRFSLAISDPHRRGPELNPLKATTTGAFRPYLRPDAELAAL
GGPAWLAEPRCAADGGPDLERWGRPQFDGPALRAAALIRLGELMSEAQGPEAARLIARDL
DFTLAMAGAPCLGPWEEEPARRSSFTLIAQWDALDLGARHLGRSDLAEAAATLAGLIAGA
ADQVTGGWRESLEAAPGTLDAATVLALVQAGRMDGPFALTAPRSRATMAALEALFAGLYP
LNRGRAAPALGRWAGDEFFGGNPWFPVTLGFAEAHYRIAAATGEAAEFDRAEALMAVVED
LAPEGDDLPEQADRETGAPSSCLGLSWSAAAYLAAAAARDQALASR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgggcggtctcggccaccgggctgagccgtcaccgcgcgggctttggctggacg
gtggtgcccgcgcccgggtcgatcctcgcctcgacgcgggtggcctcatgggatcccgag
cccgactatttccaccattggacccgcgacgccgccatcgcccttgccgccatccccgcg
gcaatggccgccgagcccgaggccgcggccttctggcgccaggcggtcgtcgatcatatc
cgcttttcgctggcgatctcggatccgcaccggcgcgggccggaactcaacccgctgaaa
gccaccacgaccggggccttccgcccctatctgcgcccggatgccgagctggcggcgctt
ggcggaccggcctggctggccgagccgcgctgtgccgccgatggcggaccagatctcgaa
cgctgggggcggccgcaattcgacgggcccgcgctgagggcagcggcgctgatccggctg
ggcgaactgatgtccgaggcgcaaggcccggaggccgcccggctgatcgcgcgcgatctc
gactttaccctggcgatggcgggggcgccctgtctcggcccctgggaggaagagcccgcc
cggcgcagcagcttcacgctgatcgcgcagtgggatgcgctggatctgggggcgcggcat
ctcggccggtcggatctggccgaggccgcggccacgctcgcgggcctgatcgccggggcc
gccgatcaggtcacgggcggctggcgcgaaagcctcgaggccgcgcccggtacgctcgat
gccgcgacggtgctggcgctggtgcaggccgggcgcatggacggcccctttgccctgacc
gcgccccggagccgggccaccatggcggcgctcgaggcactgtttgccgggctctatccc
ctgaaccggggccgcgccgcgcccgccttggggcgctgggccggggatgagttcttcggt
ggcaatccgtggtttccggtgacgctgggctttgccgaggcgcattaccggatcgcggcg
gcgaccggcgaggcggccgaattcgaccgggccgaggcgctgatggcggtggtggaagac
ctggcgcccgagggcgatgacctgcccgaacaggccgaccgcgaaaccggcgcgccgagc
tcctgcctcgggctgagctggtcggcggcggcctatcttgcggcggcggcggcccgcgat
caggcgctggcgtcgagatag

DBGET integrated database retrieval system