KEGG   Rhodovulum sulfidophilum: NHU_02895Help
Entry
NHU_02895         CDS       T04143                                 

Gene name
glpD2
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00564  Glycerophospholipid metabolism
rsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NHU_02895 (glpD2)
Enzymes [BR:rsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NHU_02895 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox FAD_binding_2 Pyr_redox_2 FAD_binding_3 FAD_oxidored NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAQ70042
UniProt: A0A0D6B4K6
LinkDB All DBs
Position
3013021..3014637
Genome map
AA seq 538 aa AA seqDB search
MPTRSAEGTATDTAEDKLADLLIVGGGINGCGIARDAAGRGLSVTLAEMDDLASATSSAS
TKLFHGGLRYLEYFEFRLVREALIERETLLSAMPHISWPMRFVLPLDREMRFDSSTPASR
LLSRAMPWMTGRRPAWLIRLGLFLYDHLGGRKLLPPTRSLDLSTDPAGRPLKPRFRRAFE
YSDCWVEDARLVALNARDAAERGAEILTRTRVVKARREDGLWTVTLRDCETGAETTRRAR
ILVNAAGPWTADLIAGALQQAPTDRVRLVRGSHIVTRRLFEHDRCYFFQGQDGRIVFAIP
YETDFTLIGTTDAEHADPDTPPRCTEEERDYLIGFVNRYLAKPVSAEDIVWTYSGVRPLH
DEGEGSASAASRDYVIRLDRTGAPLVNIFGGKITTYRRLAETALEKIAEIRPDLPGPWTA
GVALPGGDVAVDGIDGLIATLCQDYPFLTEPWARRLVRAYGTEARGVLGDAQAAADLGRD
FGATLTEVELIWLMDREFARRAEDVVWRRSKLGLRLSPDQIARIDDWMKDRRARPAPE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcgcagcgcggaagggaccgcaacggacactgcagaggacaagctggccgac
ctgctgatcgtgggcggcggcatcaacggctgcggcatcgcccgcgacgcggccgggcgc
ggattgtcggtcacgctggccgagatggacgacctggcctcggccacttcctcggcctcg
accaagctgtttcatggcgggctgcgctatctcgaatatttcgaattccggctggtccgc
gaggccctgatcgaacgcgagaccctgctgtcggccatgccccatatcagctggccgatg
cgcttcgtgctgccgctcgaccgcgaaatgcgcttcgattccagcacgcccgcctcgcgg
ctgctgagcagggcgatgccctggatgacgggacgccgcccggcctggctgatccggctc
gggcttttcctctacgaccatctcggcgggcgcaagctcctgccgccaacgcgcagcctc
gatctgagcaccgatccggccgggcggccgctcaagccccggttccggcgcgccttcgaa
tattccgactgctgggtcgaggatgcccggctggtggcgctgaatgcccgcgacgcggcc
gagcgcggcgccgagatcctgacccggaccagggtcgtgaaggcccgccgcgaggacgga
ctctggacggtcaccctgcgcgactgcgagaccggggccgagaccacgcggcgggcgcgg
atcctcgtcaatgccgccggaccctggaccgccgatctgatcgcaggcgcgctgcagcag
gcccccaccgacagggtgcggctggtgcgcggcagccatatcgtgacgcgccgcctgttc
gagcatgaccgctgctatttcttccagggacaggacggccggatcgtcttcgccatcccc
tacgagaccgatttcaccctgatcggcaccaccgatgccgaacatgccgaccccgacacc
ccgccccgctgtaccgaggaggaacgcgattacctgatcggcttcgtcaaccgctatctc
gcaaagccggtctcggcggaggatatcgtctggacctattccggggtgcggcccttgcat
gacgaaggcgaaggctcggcctccgccgcctcgcgcgactacgtcatccggcttgaccgc
acgggcgccccgctcgtgaatattttcggcggcaagatcaccacctatcgccgccttgcg
gaaaccgcgctggagaagatcgccgagatccggccggatctgcccgggccctggaccgcg
ggcgtggcgctgcccggcggcgatgtcgcggtcgacgggatcgacgggctgatcgccacg
ctctgccaggactatcccttcctgaccgaaccctgggcaaggcgtctggtgcgcgcctat
ggcaccgaggcccgcggggtcctgggcgatgcgcaggcggccgccgatctcggccgcgat
ttcggcgccacgcttaccgaggtggaactgatctggctgatggatcgcgaattcgcgcgc
cgcgccgaggatgtggtctggcgccgcagcaagctcgggctccggctgagccccgatcag
atcgcccggatcgacgactggatgaaagaccggcgcgcacgtcctgcccccgagtga

DBGET integrated database retrieval system