KEGG   Rhodovulum sulfidophilum: NHU_03085Help
Entry
NHU_03085         CDS       T04143                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00970  Aminoacyl-tRNA biosynthesis
rsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NHU_03085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsu03029]
    NHU_03085
Enzymes [BR:rsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NHU_03085
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NHU_03085
Mitochondrial biogenesis [BR:rsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NHU_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAQ70229
UniProt: A0A0D6B698
LinkDB All DBs
Position
complement(3210383..3211864)
Genome map
AA seq 493 aa AA seqDB search
MSDLTRLTIAEAREALRKGETTSVALTEAFLAEIEGADALNAFVHKTPEIALEQAKAADA
RIAAGDAPALCGMPLGIKDLFCTRGVASQAASKILDGFSPEYESTVSQNLWDAGAVMLGK
LNMDEFAMGSSNETSTYGNAVNPWKVDDRQLTPGGSSGGSASAVAADLCMAATGTDTGGS
IRQPAAFTGIVGIKPTYGRCSRWGIVAFASSLDQAGPMTRTVRDAAIMLGAMSGHDPKDS
TSADIPVPDFEAMLTGDIRGKTIGIPKEYRMEGMPAEIEKLWSDGSEMLRDAGAEIVEIS
LPHTKYALPAYYVIAPAEASSNLARYDGVRYGRRARLGQGDGIVEMYEKTRAEGFGKEVQ
RRVMIGTYVLSAGFYDAYYNRARKVRALIKRDFDEVFARGVDAILTPATPSTAFGLGEMA
DADPVAMYLNDVFTVTVNLAGLPGISVPAGLDAQGLPLGLQLIGQPWGEGELLNTAHVLE
RAAGFVSKPAKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctgaccaggctgaccattgccgaggcgcgcgaggcgctgcgcaagggcgag
accacctcggtggccctgaccgaggctttcctcgccgagatcgagggcgcggatgcgctg
aacgccttcgtccacaagacccccgagatcgcgctggaacaggccaaggccgccgatgcc
cggatcgcggcaggcgatgcgcccgcgctttgcggcatgccgctggggatcaaggatctc
ttctgcaccaggggcgtggcctcgcaggccgcctcgaagatcctcgacggcttcagtcca
gaatatgaatcgaccgtcagccagaacctctgggatgcgggcgcggtcatgctgggcaag
ctcaacatggacgaattcgccatgggctcgtcgaacgagaccagcacctatggcaatgcg
gtcaacccctggaaggtcgacgaccggcagctgacgccgggcgggtcctcgggcgggtcg
gcctcggcggtggcggccgatctctgcatggccgcgaccggcaccgataccggcggctcg
atccgccagcccgcggccttcaccggcatcgtcggcatcaagcccacctatgggcgctgc
tcgcgctgggggatcgtggccttcgcttcgtcgctcgatcaggccgggccgatgaccagg
acggtccgcgatgcggcgatcatgctgggcgcgatgtctggccatgacccgaaggattcg
accagcgccgacattccggtgccggatttcgaggcgatgctgaccggcgatatccgcggc
aagaccatcggtatcccgaaggaataccgcatggagggcatgcctgccgagatcgagaaa
ctgtggtcggacggctccgagatgctgagggatgcgggcgccgagatcgtcgagatcagc
ctgccgcacacgaaatacgcgctgcccgcctattacgtgatcgcgccggccgaggcctcg
tcgaacctcgcgcgttatgacggcgtgcgctacggccgccgggcccggctggggcagggc
gacggcatcgtcgagatgtacgagaagacccgcgccgagggcttcggcaaggaggtccag
cgccgggtgatgatcggcacctatgtgctgtcggccggcttctacgacgcctattacaac
cgcgcccgcaaggtccgcgcgctgatcaagcgcgatttcgacgaggtcttcgccagaggg
gtcgacgcgatcctgacccccgcgacgccctcgacggccttcggtctgggcgagatggcc
gatgccgatccggtggcgatgtatctcaacgatgtctttaccgtgaccgtcaacctcgcc
ggcctgccggggatctcggtgccggccgggctcgatgcccaggggctgccgctggggctt
cagctgatcggccagccctggggtgaaggcgagctgctgaacaccgcacatgttcttgag
cgggccgcgggatttgtttccaagcccgcgaaatggtggtaa

DBGET integrated database retrieval system