KEGG   Rhodovulum sulfidophilum: NHU_04319Help
Entry
NHU_04319         CDS       T04143                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rsu  Rhodovulum sulfidophilum
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NHU_04319
Enzymes [BR:rsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     NHU_04319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: BAQ71432
UniProt: A0A0D6B8J9
LinkDB All DBs
Position
complement(4421992..4423023)
Genome map
AA seq 343 aa AA seqDB search
MKACVIHGAERVLIEEAPRPAPARGQIRLRFAFGGICGSDIHYFQHGRVGDSILRGPMVL
GHEFSAVVDLLGEGVEGFAPGDKVAVTPARPCLNCDQCRRGLTNLCTDMAFMGSAARFPH
CDGGFASELVVEARQCIRLPQEADLRHVAMAEPYAVALHAAAMAGDVTGATVLVTGAGVI
GQMCATAARATGAARILMSDIAPSALARARELGVDEVFDAGDPAAMAALTDSPRCDAVFE
ASGAAPALGTAIAAAKPRGTVVQVGFLPPKAPVDLAKLLTREIRLVGTYRFIDEFAEAVR
QIVQGEVDLRPMISADMPLDRPEEAFARALDKTAALKVMVHFP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcttgtgtcatccatggtgccgagcgcgtgctcatcgaagaggcaccgcgtccg
gcccctgcccgcggacagatccgcctgcgctttgccttcggcggcatctgcgggtcggac
atccattatttccagcatgggcgggtcggcgattcgatcctgcgcggtccgatggtgctg
ggtcatgaattctcggccgtggtcgatctgctgggcgagggtgtcgagggcttcgcgccc
ggcgacaaggtggcggtgacaccggcccggccctgcctgaactgcgatcagtgccgccgg
ggcctcaccaatctctgcaccgacatggccttcatgggcagcgccgcgcgcttcccgcat
tgcgatggcggctttgccagcgaactggtggtcgaggccaggcaatgcatccgcctgccg
caagaggccgatctgcgccatgtcgccatggccgaaccctatgccgtcgcgctgcatgcc
gcggcgatggcgggcgatgtgaccggcgcgaccgtgctggtcaccggcgcgggcgtcatc
ggacagatgtgcgcgaccgcggcgcgggccaccggcgccgcccgcatattgatgagcgac
atcgccccctccgcgctggcacgggcccgcgaactgggcgtcgacgaggtcttcgacgcg
ggcgatccggcggcaatggcggcgctgaccgacagcccccgctgcgacgcggtcttcgag
gcctcgggcgcggccccggcgcttggcaccgccatcgccgccgcgaaaccccgcggcacc
gtggtacaggtgggcttcctgccgccgaaggcaccggtcgatctggcaaagctgctgacc
cgcgagatccggctggtcggcacctatcgcttcatcgacgaattcgccgaagccgtgcgc
cagatcgtccagggcgaggtcgacctgcgtccgatgatttcggccgacatgccgctcgac
cggcccgaagaggcctttgcccgggcgctcgacaagaccgcggcgctgaaggtgatggtg
cattttccatga

DBGET integrated database retrieval system