KEGG   Rhodovulum sulfidophilum: NHU_04441
Entry
NHU_04441         CDS       T04143                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NHU_04441
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rsu02044]
    NHU_04441
Secretion system [BR:rsu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NHU_04441
SSDB
Motif
Pfam: DotU OmpA APC_basic
Other DBs
NCBI-ProteinID: BAQ71554
UniProt: A0A0D6B9S7
LinkDB
Position
Plasmid1:complement(97694..99235)
AA seq 513 aa
MADNDDDDDKTVFGQPLPPPPQPPHPLTYPPGSGWNVYPQNSSGTERTAVGQTASTPGTG
VPPTPRSPGPHPFYQPGTGQRSAAAGIFPEIRRPEAAPRPAAQARIALDDALRAADAGRG
AASNPLLAEATQLLILLGRLRTGLVEMQAGPLIDHVTREIDDIERRCLAAGLPASEVRDA
KYALSATADDIVQNLPGADRAMWLQYSMVARFFGERSSGVGFFRKMDEAMKAPGQRYHLL
ELMLVCLSLGFEGQYRAMPSGAAELARIRSAIYETLRRISPRPDDDVSPHWTAVPLDARR
RGGQTPLWVIAAIAAAMLVALFATLSTLLTRQGATVRDDILALHAGQPEIAIERTEPVIA
PYQAPETTQMDRIRTALAEPLETGRVEVDQVNDWVLVRLREALRFATGSADLGNGSGPLL
AEIAAMLDGEDGPVRVVGHTDSVPMSGRGRFRSNHDLSLARAETVAERLGALVADPARLS
AEGKGATDPVAGNDTPEGRAMNRRVEIMIPRED
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcagataacgacgacgatgacgacaagaccgtgtttgggcagccgctgccgccgccg
cctcagccgccgcatccgctgacctatccgccgggctcgggctggaacgtctatccgcag
aattcctccggcaccgagcgcaccgccgtcgggcagaccgcgtccacgcccgggaccggc
gtgccgccaacgccccgctcgccggggccgcaccccttctatcagccgggcaccggccag
cgcagcgcggcggccgggatcttccccgagatccgccgccccgaggccgccccgcgaccg
gcggcccaggcgcggatcgcgctggacgatgcgcttcgggcggccgatgcgggccgcggt
gccgcctcgaacccgcttctggccgaggcgacccagcttctgatcctgctggggcggctc
cggaccgggctggtcgagatgcaggccgggccgctgatcgaccatgtcacccgcgagatc
gacgatatcgagcggcgctgcctggctgccgggctgcccgcctccgaggtgcgggacgcg
aaatacgcgctttcggccaccgccgacgacatcgtgcagaacctgcccggcgccgaccgg
gcgatgtggctgcaatattcgatggtggcgcggttcttcggcgaacgttcgtccggggtc
ggcttcttccgcaagatggacgaggcgatgaaggcgccggggcagcgctatcacctgctt
gaactgatgctggtctgcctgtcgctgggcttcgagggccagtaccgggcgatgccctcg
ggggcggccgagctggcgcggatccgcagcgccatctacgagaccctgcgccggatctcg
ccgcgccccgatgacgatgtctcgccgcattggacggcggtgccgctggatgcgcgcagg
cgcggcgggcagaccccgctctgggtgatcgcggccatcgccgcggcgatgctggttgcg
ctgttcgccacgctctcgacgctgctgacgcggcagggggcgacggtgcgcgacgatatc
ctggcgctgcatgccggacagcccgagatcgcgatcgagcgcaccgagccggtgatcgcg
ccctatcaggcgcccgagacgacgcagatggaccggatccgcaccgcgctggccgaaccg
ctcgagacgggccgggtcgaggtcgaccaggtcaatgactgggtgctggtgcggctgcgc
gaggcgctgcgcttcgccaccggctcggccgatctcgggaacgggtccgggccgctgctg
gccgagatcgcggcgatgctcgatggcgaggacggcccggtgcgggtggtcggccatacc
gacagcgtgccgatgtcggggcgcggccggttccgcagcaaccatgacctgtcgctggcc
cgggccgagaccgtggccgaacggctgggcgctctggtcgccgatccggcgcggctgagc
gccgagggcaagggcgcgaccgatccggttgccgggaatgacacgcccgaaggccgggcg
atgaaccggcgtgtcgagatcatgataccgcgggaggactga

DBGET integrated database retrieval system