KEGG   Rickettsia slovaca 13-B: Rsl_205Help
Entry
Rsl_205           CDS       T01671                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv00020  Citrate cycle (TCA cycle)
rsv00190  Oxidative phosphorylation
rsv00650  Butanoate metabolism
rsv01100  Metabolic pathways
rsv01110  Biosynthesis of secondary metabolites
rsv01120  Microbial metabolism in diverse environments
rsv01130  Biosynthesis of antibiotics
rsv01200  Carbon metabolism
Module
rsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsl_205 (sdhA)
   00650 Butanoate metabolism
    Rsl_205 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rsl_205 (sdhA)
Enzymes [BR:rsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rsl_205 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Rsl_205 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEV91839
LinkDB All DBs
Position
172183..173973
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKSIKEESLEKIINRFDKVRHANGNILVAELRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAVARKESR
GAHAREDYPDRNDEDWMKHTLSSIDEAGKVVLDYKPVTLTTLTDEVTTVPPVKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcattcatcataaatttgacgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagaagggctaaataccgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggcggaattagtgcggct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaatgctcccgatgcgatt
ttagagctagagcattacggcgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggaggaatgacaacagagtacggcaaaggaaaagcagctcagcgtacatgt
gctgcggcagatcgtacagggcatgccatactgcatactttatatcaacagtcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggcgtagttgcgtggaatttagatgacggtagtctgcattgttttagagcgcat
aatgtagtgcttgcaacgggcggatacgggcgtgcttatttttcggcgacgtctgctcat
acttgtactggtgatgggggtggcatggcgattagagccggtcttccactgcaagatatg
gaatttgtacagttccatccgacaggtatatattcggccggctgtcttattaccgagggg
gcaagaggcgaaggggggtatctcgttaatgcaaacggtgagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
atcagagaggggcgaggagtcggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgcctgagattttacatagtcgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtacttcctacggtacattataatatg
ggcgggataccgacgaattatcacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttagtagtatttggtagaagttctgcatta
aaagcagccgagcttattaagcctgcgagtccccacaagtctataaaagaagaaagtctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgcttcggtatttagaactcaa
gaggtactagatgaaggggcaggaatgattagcgaaataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagcgatttggtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagttgcaagaaaagaaagcaga
ggagctcatgcacgtgaagattatcctgatcgtaatgatgaggattggatgaagcatact
cttagctctatcgatgaagcaggtaaagtagttcttgattataaacctgtgactttaact
actttaaccgatgaagtaacaacagtcccgccggtgaagagagtgtactga

DBGET integrated database retrieval system