KEGG   Ralstonia solanacearum UY031: RSUY_06700Help
Entry
RSUY_06700        CDS       T06155                                 

Gene name
kinE
Definition
(GenBank) Sporulation kinase E
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
rsy  Ralstonia solanacearum UY031
Pathway
rsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSUY_06700 (kinE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsy01001]
    RSUY_06700 (kinE)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rsy02022]
    RSUY_06700 (kinE)
   02035 Bacterial motility proteins [BR:rsy02035]
    RSUY_06700 (kinE)
Enzymes [BR:rsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RSUY_06700 (kinE)
Protein kinases [BR:rsy01001]
 Histidine kinases
  NtrC family
   RSUY_06700 (kinE)
Two-component system [BR:rsy02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   RSUY_06700 (kinE)
Bacterial motility proteins [BR:rsy02035]
 Pilus system
  Twitching motility proteins
   RSUY_06700 (kinE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA HATPase_c PAS_8 PAS PAS_4 HATPase_c_5 PAS_9 PAS_7 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ALF87047
UniProt: A0A1C0UHN3
LinkDB All DBs
Position
739996..742059
Genome map
AA seq 687 aa AA seqDB search
MMRDASGSAQSRAGGSDAAGAGSTGMRLWSRLNAWRALRSVWLEPDPPEFQWRLLRYFAF
SRAAVALVLLLFISIPREHVTDLPASVGDAMLSLTLPYLALALLILAAAGWWRSRFQFRV
RLDVLLDLLFLGLAYATLSRLSASVAMVFLMPVLAAGALTSLLFALFTAAVASMVVLAEP
FLRMLGDGAVDSGLASAGLYGLVYMMAALMMYGLSHRQVAQERLTLARERELRLQQLVNR
LMVYDMQDGVMLVRADGRVVAANPAAAMLLGVPQNAFVGSGSVLFDLKGIPHLHPLLETL
RQWLRRQSRDPGSGIDAAGDDDATRILDLQPIAPGGRTALRARLRLRFILPSLANLRSVY
LDSLVGAIGLGLPGEAVGEPLRPRGPTTETVAQGWSADDEVFLRHELHDTVLVHVESWER
VTEQAQQEKLASMGRLVASVAHQIRNPLAAISQAAELLDDPGEGGEPLRPEGRGVETRLL
RIIRDNVRRLDQVVADVLMLSRRPRGERVRVQLAQVLPEVVERWRAEALRRAGEATEIHT
DLVRVAVDLPGPVLFDPAHLQQVAGNLLDNALRYCRRVPGSILLAAYPLDDTHAELVIWN
DGPEVSAEQQRSLFEPFFTNDAQGTGLGLYMARELCAANDAQIRYGDIALESLLDRTGAM
TMEAREALPRRAFVITLMFDQPAVPAE
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgacgcatccggctcggcacagtccagggcgggcggtagcgacgctgccggc
gccgggtcgaccggcatgcgcctgtggtcgcgcctgaacgcctggcgcgcgctgcgctcg
gtgtggctggagccggatccgcccgaattccaatggcgcctgctgcgctacttcgccttc
agccgggcggcggtggcgctggtgctgctgctgttcatctcgatcccgcgcgagcatgtg
accgacctgccggcgtccgtcggcgacgccatgctcagcctgacgctgccgtacctggcg
ctcgcgctgctgatcctggcggcggcgggctggtggcgctcgcgtttccagttccgggtg
cggctggacgtgctgctggacctgctcttcctggggctggcctatgcgacgctgtcgcgc
ctgtcggccagcgtggcgatggtgttcctgatgccggtgctggcggccggcgcgctgacc
agcctgctgttcgcgctgttcacggcggcggtggcgtcgatggtggtgctggccgagccc
ttcctgcgcatgctgggcgacggcgcggtcgactcggggctggcttccgccgggctgtac
ggcctggtctacatgatggccgcgctgatgatgtacggcctgtcgcaccggcaggtggcg
caggagcgcctgacgctggcccgcgagcgcgaactgcgcctgcagcagttggtgaaccgg
ctgatggtctacgacatgcaggacggcgtgatgctggtgcgcgccgacggccgcgtggtg
gccgccaatcccgccgcggcgatgctgctgggcgtgccgcagaatgcattcgtcggcagc
ggctccgtgctgttcgacctgaaggggattccgcacctgcatccgttgctggaaacgctg
cgccaatggctgcgccgccagagccgggatccgggtagcggcatcgacgcggccggcgat
gacgatgccacgcgcatcctcgatctgcagccgatcgccccgggcggtcgtaccgcgctg
cgtgcccgcctgcgcttgcgctttatcctgccgagcctggcaaacctgcgcagcgtctat
ctggacagcctggtcggcgcgatcggcctgggcctgccgggcgaggccgtgggcgagccg
ctgcgcccgcgcggccccacgaccgagaccgtcgcgcaaggctggtccgccgatgacgag
gtctttctgcgccacgagctgcacgacactgtgctggtgcacgtggagagctgggagcgc
gtgaccgagcaggcccagcaggaaaagctggcctcgatggggcggctggtggcgagcgtg
gcgcaccagatccgcaatccgctcgcggccatcagccaggcggccgaactgctggacgac
ccgggcgagggcggcgagccgctgcgcccagagggccgcggcgtggagacgcgcctgctg
cgcatcatccgcgacaacgtgcgccgcctcgaccaggtggtcgccgacgtgctgatgctg
tcgcgccggccgcgcggcgagcgcgtgcgggtgcagctcgcgcaggtgctgcccgaggtg
gtggagcgctggcgtgccgaggcgctgcgccgcgcgggtgaggcgaccgagattcacacc
gatctggtgcgcgtggccgtcgacctgccggggccggtgctgttcgatccggcccatctg
cagcaggtggccggcaacctgctcgacaacgcgctgcgctattgccgccgcgtgccgggc
tcgatcctgctggcagcctatccgctggatgacacccatgccgaactggtgatctggaac
gacggccccgaggtttccgccgagcaacagcgcagcctgttcgagccgttcttcaccaac
gacgcgcagggcacggggctcggcctctacatggcccgcgagttgtgcgctgccaacgac
gcgcagatccgctacggcgacatcgcgctcgaatccttgctcgatcgcaccggagcgatg
accatggaggcgcgcgaggccctgccgcgccgcgcgttcgtcatcaccctgatgttcgac
caacccgctgtgccggcggaatga

DBGET integrated database retrieval system