KEGG   Ralstonia solanacearum UY031: RSUY_17560Help
Entry
RSUY_17560        CDS       T06155                                 

Definition
(GenBank) putative 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD
Organism
rsy  Ralstonia solanacearum UY031
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ALF88096
UniProt: A0A1C0UF74
LinkDB All DBs
Position
complement(1872659..1873552)
Genome map
AA seq 297 aa AA seqDB search
MALIVLKIDVDTLRGTREGVPNLVRMLRAHEAGATFLFSLGPDHTGWALRRAFRPGFLKK
VSRTSVVEHYGLRTLMYGVLLPGPDIGRKAAAEMRAVAEAGFETGIHTWDHVRWQDNVRQ
RDAAWTARQMGAAHKRFAEIFGHAPVTHGAAGWQMNDHAFRQIDAWGMAYASDGRGMHPY
IPSVDGQPLGHVQLPTTLPTLDELIGVNDLTADNVARHILKTTESDRDQVFTLHAELEGQ
KLAPIFEELLRGWRAQGHRLVSMGDYHATLDRSTLPVQPVTWGEIPGRSGSLIVQPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccctcatcgtcctcaagatcgacgtcgacaccctgcgcggcacgcgcgaaggcgtt
cccaacctcgtgcgcatgctgcgcgcgcacgaggcgggcgcgaccttcctgttcagcctg
gggcccgaccacaccggctgggccctgcgccgggccttccgccccggcttcctgaaaaaa
gtgtcgcgcacctcggtggtcgagcactacggcctgcgcacgctgatgtacggcgtgctc
ctgcccggccccgacatcggccgcaaggccgccgccgagatgcgtgcggttgccgaggca
gggttcgagaccggcatccacacctgggatcacgtccgctggcaggacaacgtgcgccag
cgcgatgccgcctggacggcccgccagatgggtgccgcccacaagcgctttgccgagatc
ttcgggcatgcgcctgtcacgcacggcgccgccggctggcagatgaacgaccacgccttc
cgccagatcgacgcctggggcatggcctacgcctccgacggccgcggtatgcatccctac
atcccgagcgtcgacggccagccgctcgggcatgtgcagttgccgaccaccctgccgacg
ctggacgaactcatcggcgtgaacgacctgaccgccgacaacgtcgcccggcatatcctg
aagacgaccgaatcggaccgcgaccaggtgtttaccttgcatgcggagcttgaagggcag
aaactcgccccgatcttcgaagaactgctgcgaggctggcgcgcccagggccatcggctg
gtgtcgatgggcgactaccatgcaacgctggaccgcagcaccctccccgtgcaacccgtc
acgtggggcgaaatcccgggccgcagcggcagcctgatcgtgcagccggcctga

DBGET integrated database retrieval system