KEGG   Ralstonia solanacearum UY031: RSUY_22810Help
Entry
RSUY_22810        CDS       T06155                                 

Gene name
drrA_2
Definition
(GenBank) Daunorubicin/doxorubicin resistance ATP-binding protein DrrA
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
rsy  Ralstonia solanacearum UY031
Pathway
rsy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RSUY_22810 (drrA_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsy02000]
    RSUY_22810 (drrA_2)
Transporters [BR:rsy02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    RSUY_22810 (drrA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 AAA_23 MukB AAA_30
Motif
Other DBs
NCBI-ProteinID: ALF88606
UniProt: A0A072SWS5
LinkDB All DBs
Position
2451503..2452468
Genome map
AA seq 321 aa AA seqDB search
MRYEQPPGPGIGSTPILSVEGLCKRYGEQTVVDGLSFSVRRGQCFGLLGPNGAGKTTTLR
MLLGMTMPDAGTLQLCGETVPGHAHRARMRVGVVPQFDNLDPDFTVSENLHIFGRYFGLP
AATIRTRMPGLLEFARLEQKADAPVRALSGGMKRRLTVARALINDPDVLVMDEPTTGLDP
QARHLIWERLRSLLASGKTILLTTHFMEEAERLCDELCVIDNGRKIAQGKPHELIAHEIG
CDVVEVYGDDLPALRTLLSPLAERVETSGETLFCYARDPQPLVASLRAQTETHAMPGLRY
LHRPANLEDVFLRLTGREMRD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatacgagcaaccgcccggcccgggcatcggcagcacaccgatcctgagcgtcgaa
gggctgtgcaagcgctacggcgaacagaccgtggtcgacggcctgagcttttcggtacgc
cgcggacaatgcttcggactgctgggccccaacggcgcgggcaagaccaccacgctgcgc
atgctgctcggcatgacgatgcccgatgcgggcaccctgcagctgtgcggcgagaccgtg
cccggacacgcgcaccgcgcgcgcatgcgcgtgggcgtggtcccgcagttcgataacctc
gaccccgacttcaccgtctcggaaaacctgcacatcttcggccgctatttcggcctgccc
gccgcgaccattcgcacgcggatgccgggcctgctggaattcgcgcggctcgagcaaaag
gccgacgcccccgtgcgcgccctgtcgggtgggatgaagcgacggctgacggtcgcgcgg
gcgctgatcaacgaccccgatgtcctcgtgatggacgagcccaccaccggactcgacccg
caggcgcgccacctgatctgggaacgcctgcgctcgctgctcgcatcgggcaagaccatc
ctgctgaccacgcacttcatggaagaggccgagcgcctctgcgacgaactgtgcgtgatc
gacaacggccgcaagatcgcccagggcaaaccgcacgaactgatcgcgcacgagatcggc
tgcgatgtcgtcgaagtctacggcgacgacctgcccgccctgcgcaccctgctcagcccc
ctggccgagcgcgtggaaaccagcggcgagacgctgttctgctacgcccgcgatccgcag
ccgctggtggcctccctgcgcgcgcagaccgagacgcatgccatgcccggcctgcgctac
ctgcaccgccccgccaacctcgaagatgtgttcctgcgcctgaccggccgcgagatgcgc
gactga

DBGET integrated database retrieval system