KEGG   Ralstonia solanacearum UY031: RSUY_35840Help
Entry
RSUY_35840        CDS       T06155                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rsy  Ralstonia solanacearum UY031
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSUY_35840 (ahpF)
Enzymes [BR:rsy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RSUY_35840 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_2 FAD_binding_3 Thi4 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ALF89895
UniProt: A0A073A9I4
LinkDB All DBs
Position
unnamed:485227..486801
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKSYLERLVQPIELVASIDDSEGSRDMMDLLRDVAGQSSLIALNEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDTIEQIRNLDGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGGLFQDEVEARKIMAVPTLFLNGEV
FSQGRMGVEEILAKIDTGAAARDAEKLNARAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTLAIENFVSVQETEGPKFAAALEQHVRQYGVDIMNAQRAVKLVPADEPG
GLSEVTLANGAVLQGRSIILSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLQSLPNATILTNAQTTEITGN
GEKVNGLRYKNRTNGVEHDVALEGVFVQIGLVPNTEWLDGVVERNRFGEVIVDARGHTSV
SGVFAAGDSTTVPFKQIIIATGEGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaagtcctacctcgaacgcctcgtgcagccc
atcgagctggtcgcctcgatcgacgacagcgagggctcccgcgacatgatggacctgctg
cgcgatgtcgccgggcagtccagcctgatcgcgctcaacgaacagcgcgacgatgccgag
cgcaagccgtcgttcctgatccgccgtaccggcaccgatgtcggtgtccgcttcgcggcc
atcccgacgggccacgagttcacttcgctcgtgctggcgttgctgcaggtgggcggctac
gcccccaagctcgatgacgacaccatcgaacagattcgcaatctcgacggcgatttccgc
ttcgagacctatatgtccctgacgtgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgccatcgacggcgggctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcctgaacggagaagtc
ttcagccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgcc
gcccgcgacgccgagaagctcaacgcccgcgcaccgtacgacgtgctgatcgtcggcggt
ggcccggcgggcgcggcagcggccgtgtacgcggcgcgcaagggcgtgcgcaccggcgtg
gtggccgagcgcttcggcggccaggtgctggacacgctggccatcgagaacttcgtctcc
gtgcaggagaccgaagggccgaagttcgccgctgcgctggagcagcacgtgcgccagtac
ggcgtcgacatcatgaacgcgcagcgcgccgtcaagctcgtgccggccgacgagccgggc
ggtttgtccgaggtgacgctcgccaacggcgcggtgctccagggccgctcgatcatcctg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggtgaacaggaataccgtaaccgc
ggcgtggcgtactgcccgcactgcgacggcccgctgttcaaaggcaagcgcgtggccgtg
atcggtggcggcaactccggcgtggaagccgcgatcgacctggcgggcatcgtcagccac
gttacgctgctcgagttcggcgaccagctcaaggccgacgccgtgctggtgcgcaagctg
cagagcctgcccaacgcgaccatcctcaccaacgcgcagaccaccgagatcaccggcaac
ggcgaaaaggtcaacggcctgcgctacaagaaccgcaccaacggcgtcgagcacgacgtc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcgacggc
gtggtggagcgcaaccgcttcggcgaggtcatcgtcgacgcgcgcggccacaccagcgtg
tcgggcgtgttcgcggcgggggattcgaccaccgtgccgttcaagcagatcatcatcgcc
acgggcgagggcgccaaggccgcactgtccgccttcgatcacctgatccgggtgccgctg
gccgaagccgcctga

DBGET integrated database retrieval system