KEGG   Raphanus sativus (radish): 108817637Help
Entry
108817637         CDS       T06014                                 

Definition
(RefSeq) calcium-dependent protein kinase 29
  KO
K13412  calcium-dependent protein kinase [EC:2.7.11.1]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    108817637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsz01001]
    108817637
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108817637
Protein kinases [BR:rsz01001]
 Serine/threonine kinases: CAMK group
  CDPK family
   108817637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase EF-hand_1 Pkinase_Tyr EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 Kinase-like EF-hand_11 SPARC_Ca_bdg EFhand_Ca_insen Kdo RIO1 tRNA_synt_1c_R1
Motif
Other DBs
NCBI-GeneID: 108817637
NCBI-ProteinID: XP_018445879
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MFKKLNKATRNKRNQNTRTRHFFKNHIMGFCFSKSQTHEIPISSSSDSTPPHRYQPLPKP
TNNPQTQTSTFPTTPKPKPAPPPSSSSGSQIGPILNRPMIDLSALYDLHKELGRGQFGIT
YRCTDKSNGREYACKSISKRKLIRQKDIEDVRREVMILQHLTGQPNIVEFRGAYEDKDNL
HLVMELCSGGELFDRIIKKGSYSEKEAADIFRQIVNVVHVCHFMGVVHRDLKPENFLLVS
TDDDSPIKATDFGLSVFIEEGKVYKDVVGSAYYVAPEVLYRNYGKEIDVWSAGVMLYILL
CGVPPFWGETEKTIFEAVLEGQLDLESSPWPSISESAKDLIRKMLARDPKTRITAAEALE
HPWLTDSEVSDKPIDSAVLIRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQMFKNIDT
DGSGTITFDELRTGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEFITATMHRHRLEKE
EHLLEAFKYFDKDRSGYITRDELKHSMTQYGMGDDATIDEVINDVDTDNDGRINYEEFVA
MMTKGTTDPDAKLIR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaactcaataaagccaccagaaacaagagaaaccaaaacactcgaacaaga
cattttttcaaaaaccacataatgggtttctgcttctccaagtcacaaacacatgagatc
ccaatctcttcttcttccgattccacccctcctcatcgctaccaacctctccccaaacca
accaataatcctcaaacccaaaccagtacttttcccaccactcccaaacccaaaccggct
cctccaccttcctcctcctccggttcacaaatcggtccaatccttaaccgaccaatgatc
gatctctcggctctctacgacctccacaaagaactcggccgcggccagttcggcatcacg
taccgttgcactgacaaatccaacggccgagagtacgcatgcaaatcgatctcgaaacgc
aaactcatccgtcagaaagacatcgaagacgtgagacgcgaggtcatgatcttgcagcac
ctcaccggtcagccaaacatcgtcgagtttcgaggcgcctacgaggataaagacaatctt
catttagttatggagctttgctccggaggcgagttattcgatcgtattatcaagaaaggg
agttactctgagaaagaagctgctgatattttcagacagatcgtgaacgttgttcatgtt
tgtcatttcatgggtgttgttcatagagacttgaagcctgagaacttcttgcttgttagt
acggatgatgattctcctattaaagctactgactttggtctctctgttttcatcgaagaa
ggcaaagtgtacaaagatgtagttggtagcgcatactacgtcgcacccgaagttctatat
cgaaactacgggaaagagatcgatgtatggagtgctggtgtcatgctttacattcttcta
tgcggtgttcctccattttggggtgagaccgagaagactatatttgaggcggtattagaa
ggacagttagaccttgaatcttctccttggccttctatatcggaaagcgcaaaagacttg
ataaggaagatgttggcaagagaccctaaaacacggattacagcagctgaagcacttgag
catccatggttgacagatagcgaagtttcagataaaccaatagatagtgcagtccttatt
aggatgaagcagttccgcgcaatgaacaagctcaagaaacttgccttgaaggtcatagct
gaaaacttatcagaagaagagattaagggactaaagcagatgtttaagaacattgataca
gatggaagtggtaccatcacttttgatgaacttagaaccggtctacatcgtcttggatct
aaacttactgaatctgaaatcaaacaactcatggaagctgctgatgtggacaaaagcggg
acgattgattacattgagttcataacagctacaatgcatcggcatagattggagaaagag
gagcatttgctagaagcattcaaatactttgacaaagacagaagcggatacatcacaagg
gacgagctaaaacattcgatgactcagtatggaatgggtgacgatgctaccatagatgaa
gtcatcaatgatgtcgatacagacaacgatgggagaataaactacgaggagtttgtggcg
atgatgacgaagggaactacagatccagatgcgaagctgatcagatga

DBGET integrated database retrieval system