KEGG   Raphanus sativus (radish): 108819264Help
Entry
108819264         CDS       T06014                                 

Definition
(RefSeq) fanconi-associated nuclease 1 homolog isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rsz03400]
    108819264
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     108819264
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     108819264
DNA repair and recombination proteins [BR:rsz03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     108819264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC HIRAN
Motif
Other DBs
NCBI-GeneID: 108819264
NCBI-ProteinID: XP_018447767
LinkDB All DBs
Position
Unknown
AA seq 875 aa AA seqDB search
MLTGHESLLRLIGKRRRSLPNRQNLLSVATPNSLNLDVNDSGNDPSPDDSSTFSDDLRKK
RRLTQTTLLQWSGSKQSEDTLFIHTQQQQSITVCNLDYDDGSCSEEVSKTVAALDEANGG
DEAIHTFIVGRKFSDVQVLETGAKISLLRHPQNIKDPNAIKVLYAESELSEMLGYLPKDV
SQCLSPLIDEYDLKFEGTITSVPKISSEAVPIKVVCHKMTSDGWKESESAGEDFKLLWEK
VLQVVEHQMQTTRYQLNFNVLVQEVLRSCSHLFTDDEKAFLESFPSLSEDSQRLFIRLYT
RKGPWFRLSNISYSEVSDSLQALKDLTVRGFMTSVEDANDLSYQMMKEITELLNVTELRD
ILSMNKVHSRSSRKRDLINSLCSYYNDGTRMNIGTMILERTGLCAKISSTAETLIWRVER
LFFLNGEQDLSSFVLLDLGIIKYPTYKCIDSEQIFSDRTKLLAYEEVFLLVHIAKKGLVC
LYSLSKLQLQAIEVAQLMDESLDSEDSGTVLNCIRIAETRITSSSSEPALLAAFNCFTAP
WVYSKMVLLGVSFLENQKRYNQAVHLLRRLLSSFSCDGRRGYWTVRLSTDLEHMGRPNES
LSVAEQGLLDPWVRAGSRIALQRRILRLAKPPRRWKTPTFPNLNDNKIPEVTIQGRSLNC
EVGMKNRFYGEDGEQCGVEKLALQYYNGKGGGWQGMHTESSIWLTIFGLLMWDILFSDVP
GVFQTRFQTAPLDLDTESFYLTRKEAIESQLEKVANGMAEEILIISYETHRGTACRGVAW
ERFSLEELRAAVACVGGKCVASLCRYLAQDYRSWCSGMPDLLLWRFKENGYEGEAKLVEV
KSEKDRLSEQQRAWLLLLMDSGFHVEICKVRPACA
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccggacatgagagcttgcttcggttgatcggaaaacgccgccgatctctcccc
aaccgccagaatcttctctccgttgctactccgaactcgttgaatctcgatgtcaacgac
tccggcaatgacccttctcccgatgactcgagcacattctcagatgatttgaggaagaaa
cggagattaactcagaccactcttcttcagtggtcaggttcgaaacaatctgaagatact
cttttcatccatacccagcagcagcaatcaataaccgtctgcaatcttgattatgatgat
ggctcatgtagtgaggaggtttccaaaactgtggctgctttagatgaagccaatggtggt
gatgaagctattcatacctttattgttggtaggaagtttagtgatgttcaggttttagaa
actggggcaaagatctctcttttgagacaccctcagaacattaaggatcccaacgctatt
aaggttctttatgcagagtccgagttgtctgagatgcttgggtatctacccaaagatgtt
tcccagtgcttgtccccgcttatcgacgagtatgaccttaagtttgagggaacaataact
tctgttccgaagatttcttctgaagctgttccgattaaagttgtttgtcacaagatgaca
tctgatggttggaaagaaagtgaatctgctggtgaagattttaagcttctgtgggagaaa
gttcttcaggttgttgagcatcagatgcaaacgacgagataccaattgaacttcaatgtg
ttggtacaagaggttctcagaagctgctctcacctattcacagacgatgaaaaggcattc
ttggaatccttcccatctctttcagaggatagccagagacttttcatccgtctttacaca
cgaaaaggaccttggttcaggctatcaaatatttcatactctgaggtatctgattctctt
caagctctgaaagatctaacagttaggggattcatgacttcagtggaagacgcaaatgat
ctaagttaccaaatgatgaaggagatcacagagttgcttaacgtcactgaactgcgtgat
atcttatctatgaacaaggtgcacagccgcagttcaagaaagagagaccttataaattca
ctttgttcttattacaacgatggaacaaggatgaatataggaacaatgattctagaaaga
acaggactatgtgctaagatatccagtacagcagaaactctcatatggcgtgttgagagg
cttttctttctcaacggggagcaagatctatcctcttttgttctgctggatcttggtatt
atcaaatacccaacttacaagtgcattgactcagagcagatattttcagaccggactaag
ctattagcatatgaagaggtgtttttacttgtccatattgccaaaaaagggcttgtttgt
ctatacagtctctcaaagcttcaattacaggccattgaagtggctcagttgatggatgag
tctcttgacagtgaggattctgggacagtgttgaactgcatcaggattgctgagacccgc
ataactagttcatcttcagaacctgctctcctagcagcttttaattgctttacagctcca
tgggtttactcaaaaatggttcttttaggagtttcctttcttgagaaccaaaagaggtat
aaccaagcagttcatctactgagacggctgcttagttccttcagttgtgacgggagacga
ggatactggacagtcaggttatcaacagatttggagcacatgggacgtccaaacgagagt
ctttcagtggcagaacaaggactattggatccatgggtgcgtgctggttcaagaatagct
ttgcaaagacgcattcttcgtcttgcaaagcctccaagacgctggaaaacccccaccttc
ccaaatctcaacgacaacaagatccctgaggtcaccattcaagggagatcactgaactgt
gaagttggcatgaaaaacaggttttatggagaagacggagagcagtgtggagttgagaag
ctcgcattgcagtattacaatggaaaaggaggaggatggcaggggatgcatacagagagt
agcatctggttaaccatttttgggcttctcatgtgggacattctgttttctgacgtccct
ggtgtcttccaaacccggttccagactgctccactggacttagatactgaatccttctat
ctaaccaggaaggaagcaatagagtcacagctcgagaaagttgcaaacggaatggctgaa
gagatactcatcatctcatatgaaacacaccgtggaacagcgtgcagaggagtggcgtgg
gagcggttttcgttagaggaactgagagcagcggtggcttgtgttggaggcaagtgtgta
gcatcgctttgccgatatctagctcaagactacaggagctggtgcagtggaatgcctgat
ctgcttctgtggcggttcaaggagaatggttatgaaggtgaagctaagcttgtggaagta
aaatcagagaaagataggttatcagaacagcaacgtgcttggcttctgcttctaatggat
tcaggcttccatgttgagatttgcaaagtaagacctgcttgtgcttaa

DBGET integrated database retrieval system