KEGG   Raphanus sativus (radish): 108823332
Entry
108823332         CDS       T06014                                 

Definition
(RefSeq) cytochrome P450 704B1
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00071  Fatty acid degradation
rsz00073  Cutin, suberine and wax biosynthesis
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108823332
   00073 Cutin, suberine and wax biosynthesis
    108823332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rsz00199]
    108823332
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     108823332
Cytochrome P450 [BR:rsz00199]
 Cytochrome P450, plant type
  CYP704 family
   108823332
SSDB
Motif
Pfam: p450 DUF1415
Other DBs
NCBI-GeneID: 108823332
NCBI-ProteinID: XP_018452012
LinkDB
Position
Unknown
AA seq 519 aa
MSMWIVLACMVTSWIFVHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRT
VVVPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQR
KTASFEFASKNLRDFSTVVFKEYSLKLFSVLCQASFKDQQVDMQELLMRMTLDSICKVGF
GVEIGTLAPELPENRFAKAFDTANIIVTLRFIDPLWKMKKYLNIGSEALLGKSIKVVDDF
TYSMIRRRKAEILEAHKSPSINIKMKHDILSRFIEISDDPDSKSTEKSLRDIVLNFVIAG
RDTTATTLTWAIYMIMMHEHVAEKLCSELKELERDKAEETNTPLCHYDTEDFKSFNERVT
QFAGMLNYDSLGKLHYLHAVVTETLRLYPAVPQDPKGVLEDDILPNGTKVKAGGMVTYVP
YSMGRMEYNWGSDAATFKPERWLKDGMFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAM
ATLCRFYRFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtctatgtggatcgttctagcttgcatggtgacatcttggatcttcgtgcaccgatgg
ggacagaggaataagagaggtcccaagacatggcctttggtcggagcagccatcgagcag
ttgaccaattttgaccgaatgcacgattggctcgttgagtatctttacgactcaagaacc
gtagtggttcccatgcccttcaccacttatacatacatagcagatcccatcaatgtagaa
cacgttctcaaaaccaatttctccaactacccaaagggagagacgtaccattcgtatatg
gaagttttgctgggagatgggatcttcaattcagatggagagctttggaggaaacagagg
aaaaccgcgagtttcgagtttgcttccaagaatctcagagacttcagtaccgtagtgttt
aaagagtacagcctcaagctcttctccgtcctttgtcaagcttctttcaaagaccaacaa
gtagacatgcaggaattgttgatgagaatgactctagactccatatgtaaagtggggttt
ggtgtggagataggaacattagctccagagttaccagagaatcgctttgctaaggctttc
gatactgcaaatataattgtaacacttcgtttcatagaccctctttggaagatgaaaaag
taccttaacataggctctgaggcactacttggaaagagcataaaagtcgtcgatgatttc
acctattcaatgataagaagaaggaaagcagagatattagaggcacataaatctccttcc
atcaacatcaagatgaagcatgatatactctcgaggttcattgagatcagcgacgatcct
gacagcaaatcaactgagaaaagtctaagagatatagtcctcaattttgttattgctgga
agagatacaacagcaacaactctcacttgggctatatacatgataatgatgcatgaacat
gtcgccgagaagctttgctcagagcttaaagaactcgaaagagacaaggcagaagagact
aacacaccgttgtgtcattacgatacagaggatttcaagtcctttaacgagagggtaaca
cagtttgcaggaatgctaaattatgattccttaggaaagctacactacttacacgcagtg
gtaacagaaacacttcgtctctaccctgcggttcctcaggatccaaaaggagtgttagaa
gatgatatattacctaatggaacaaaggtgaaagcaggaggtatggtaacatatgttcct
tactcaatgggtcgtatggagtacaactggggatcagatgcagctacgtttaaaccagaa
agatggcttaaagatgggatgtttcagaacgcttccccattcaagttcacagcatttcag
gctggacctaggatatgcttgggaaaggattcagcttatctacaaatgaagatggcaatg
gcaactctttgcagattctatagattccatttggtgccaaatcaccctgtcaagtatcgg
atgatgactatcttatctatggcgcatggtttgaaagttaccgtctctagacgttcatag

DBGET integrated database retrieval system