KEGG   Raphanus sativus (radish): 108827776Help
Entry
108827776         CDS       T06014                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00040  Pentose and glucuronate interconversions
rsz00051  Fructose and mannose metabolism
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108827776
   00051 Fructose and mannose metabolism
    108827776
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108827776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP UDPG_MGDP_dh_N Methyltransf_25 Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 108827776
NCBI-ProteinID: XP_018456762
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MGKGGMSQGEGSKVEEENMAAWLVGLNTLKIQPFPLPSLGPHDVRVRMKAVGICGSDVHY
LKTMRCADFIVKEPMVIGHECAGIIEEVGEGVKHLVVGDRVALEPGISCWRCNLCKEGRY
NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEVG
PETNVLVMGAGPIGLVTMLAARAFGVPRIVIVDVDDNRLSVAKQLGADGIVKVTTSLEDV
GFEVEQIKKAIGSNVDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAAA
REVDVVGVFRYKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggaggaatgtctcagggagaaggctcaaaggttgaagaagagaacatggct
gcttggttggttggtctcaacactctcaagatccaaccttttcctcttccttcccttggt
cctcatgatgtgagagttaggatgaaggctgttggaatttgtggaagtgatgttcattac
ctcaagaccatgagatgtgcggatttcattgtgaaagaaccgatggtgattggacatgaa
tgcgctgggatcattgaagaggtaggtgaaggagtgaaacatctagtggtcggtgaccga
gtggctcttgagcctgggattagttgctggagatgcaacctctgcaaggaaggaagatac
aatctttgtcctgagatgaagttctttgcaaccccaccggttcatggctctctagcaaac
caagtggttcaccctgcggatctatgttttaaattgcctgagaatgtgagtttggaggaa
ggagcaatgtgtgagccactaagtgttggcgtgcatgcttgtcgccgagctgaggttggt
cctgagacaaacgtgttggtaatgggagccggacctattggacttgtcaccatgttggct
gctcgtgctttcggtgtgccaaggattgtgattgtggatgttgatgataaccgtttatct
gtagccaaacagctaggtgcagatgggattgtcaaagtgacaacaagcttagaggatgtt
ggttttgaggttgaacaaattaagaaagctatagggtcaaacgtcgatgtgacattcgat
tgtgcgggtttcaacaaaacaatgtcgacggcattagcagccactcgatgcggcgggaaa
gtatgccttgtcggaatgggtcatggtataatgactgtccctctcactcccgcagccgca
agggaggtagatgtggtgggtgtgttcaggtacaagaacacatggcctttgtgtctcgag
ttccttacaagtggtaagattgatgtgaagccactcataacccacagatttggtttctct
cagaaggaagtggaagatgcctttgaaaccagtgctcgtggaagcaatgctattaaagtt
atgttcaatctctga

DBGET integrated database retrieval system