KEGG   Raphanus sativus (radish): 108836980Help
Entry
108836980         CDS       T06014                                 

Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1-like
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00062  Fatty acid elongation
rsz01040  Biosynthesis of unsaturated fatty acids
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01212  Fatty acid metabolism
Module
rsz_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    108836980
   01040 Biosynthesis of unsaturated fatty acids
    108836980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rsz01004]
    108836980
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     108836980
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     108836980
Lipid biosynthesis proteins [BR:rsz01004]
 Fatty acid synthase
  Component type
   108836980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 108836980
NCBI-ProteinID: XP_018465566
LinkDB All DBs
Position
Unknown
AA seq 320 aa AA seqDB search
MEICTYFKSQPTWLLLLFLLGSLSLLKFTFTLLTSLYIYFLRPGKNLRRCYGSWAIITGP
TDGIGKAFAFQLAHKGLNLVLVARNPDKLKHVSDSITSKHPNTQIKTVLMDFSGDIDGGV
GRIEEAIEGLEVGILINNAGVSYPYAKYFHEVDEELLGSLIKINVEGTTKVTKAVLGNML
KRKRGAIVNMGSGAAALIPSYPFYSVYAGAKTYVDQFSKCLHVEYKKSGIDVQCQVPLYV
ATKMTKIRRASFLVASPEGYAKAALRFVGYEPRCTPYWPHALMGYVVSALPESVFESFNI
KRCLQIRKKGMLKDSSSKKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagatctgcacttacttcaaatcccaacccacatggctcctcctcctcttcctcctc
ggctccctctccctcctcaagttcaccttcaccctcctcacctccctctacatctacttc
ctccgccccggcaaaaacctccgccgctgctacggctcctgggccatcatcaccggcccc
accgacggcatcggcaaagccttcgcctttcagctcgcccacaaaggcctcaacctcgtc
ctcgtcgcccgcaaccccgacaagctcaaacacgtctccgactccatcacgtccaagcac
cccaacacccagatcaagaccgtcctcatggacttctccggagacatcgacggaggcgtg
gggaggatcgaggaggcgatcgagggtctcgaagtcgggatcttgatcaacaacgctggg
gtctcgtatccgtacgctaagtattttcacgaggttgatgaggagctgcttgggagcttg
attaagattaatgttgaagggacgacgaaggttacgaaggctgtgttggggaatatgctg
aagaggaagcgtggggcgattgttaatatgggttctggtgctgctgctcttatcccttct
tatcctttctactctgtttatgccggcgctaaaacgtatgtggatcagttctcaaagtgt
ctccatgttgagtacaagaagagtgggattgatgttcaatgccaggtgcccttgtacgtt
gcgacaaagatgactaagattaggagagcgtctttcttagttgcatctccagagggttac
gcaaaggcagcactacgttttgtagggtacgaaccacgttgcacaccttactggcctcac
gcactcatgggttatgttgtctctgcattgcccgaaagcgtctttgaatccttcaacatt
aagaggtgcctccagatccggaagaagggcatgcttaaagactcctccagtaaaaaggaa
taa

DBGET integrated database retrieval system