KEGG   Raphanus sativus (radish): 108839298Help
Entry
108839298         CDS       T06014                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00562  Inositol phosphate metabolism
rsz01100  Metabolic pathways
rsz04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108839298
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108839298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rsz01009]
    108839298
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108839298
    3.1.3.48  protein-tyrosine-phosphatase
     108839298
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108839298
Protein phosphatases and associated proteins [BR:rsz01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108839298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase DUF4070
Motif
Other DBs
NCBI-GeneID: 108839298
NCBI-ProteinID: XP_018467591
LinkDB All DBs
Position
Unknown
AA seq 192 aa AA seqDB search
MGLKLSRGPGKEKSTLLQQTRVHILTYLTTSFYLRNLVSKKRRRLITAGYDLDMSYISDK
LLAMSFPAERMRAVYRNPLWQVKSVLDMRHPHHYKVYNLCIEECYDPENFYGRVERFPFD
DNHVPSLKMIQLFCQSVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYSGMTAEEALE
MYASRRTTNNNG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtctaaagctctcaagagggcctgggaaagagaaatcaactcttctgcaacaaacg
agggttcacattctgacgtacctaaccacaagtttttacctacgtaacttggtgtccaag
aaacgaaggcggttaatcaccgctggatacgatctcgacatgtcttacatatccgacaaa
ctcttggctatgtcttttcccgccgaaagaatgagagcagtttatagaaaccctctttgg
caagtcaagtccgtgctagatatgcgacatcctcatcattacaaggtctataacctatgc
atagaggaatgttatgatccagagaacttctatggacgcgtggagagattcccgtttgat
gacaaccatgtcccatctcttaaaatgatccaacttttctgccaaagtgttcattcttgg
ctctcattagatcccaaaaacattgctgttgtccattgcatggcaggaaaaggtaggaca
gggctaatggtatcagcgtaccttgtgtatagtggaatgacagctgaagaagctcttgag
atgtatgcaagcagaagaaccactaacaataatgga

DBGET integrated database retrieval system