KEGG   Raphanus sativus (radish): 108841906Help
Entry
108841906         CDS       T06014                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00071  Fatty acid degradation
rsz00592  alpha-Linolenic acid metabolism
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01212  Fatty acid metabolism
Module
rsz_M00087  beta-Oxidation
rsz_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108841906
   00592 alpha-Linolenic acid metabolism
    108841906
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     108841906
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     108841906
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     108841906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored Pyr_redox_2 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 108841906
NCBI-ProteinID: XP_018470191
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MAKKIGVTMEVGNDGVAVITISNPPVNSLASPIISGLKEKFQDADQRNDVKAIVLTGNGG
RFSGGFDINVFQQVHKTGDISLMPEVSIDLVSNLMEDSRKPLVAAVEGLALGGGLELAMA
CHARVAAPKAQLGLPELTLGVIPGFGGTQRLPRLVGLAKATDMILLSKSISSEEGHMLGL
VDALVPPGDLLTTSRKWALDIALGRKPLLRSLHRTDKIGSLSEARAVLKNTRQLAKKIAP
NMPQHHACIDVIEEGIVHGGYSGVLKEAEVFKQLVMSDTAKALVHVFFAQRATSKVPNVT
DVGLKPRPMKKVAVIGGGLMGSGIATALLLSNTRVVLKEINPEYLQKGLKSVEANLKSLV
SRGKLTQDKAGKALSLLKGALDYAEFKDVDMVIEAVIENIELKQKIFKEIEEICPPHCIL
ASNTSTIDLNVIGEKTNSKDRIVGAHFFSPAHIMTLLEIVRTENTSAQVILDLMALGKAI
KKVPVVVGNCIGFAVNRTFFPYTQGAHMLVNLGVDLFRVDRVITSFGLPLGPFQLGDLAG
HGIGMAVKEIYAKVYGDRMFQSPLTELLVKSGRNGKINGRGYYIYEKGSKPKPDSSVLSV
VEESRKLTNIMPGGKPISVTDKEIVEMILFPVVNEACRVLDEGVVIRASDLDVASVLGMS
FPSYRGGIVFWADTVGPKYIYERLKRLSETYGGFFKPSRYLEERAMNGMLLSEPKASRSR
M
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagataggagtgacgatggaagtcggaaacgatggtgttgctgtgatcacc
atttccaatcctcccgttaactctttggccagcccaattatttctgggttgaaggagaag
tttcaagacgcggatcagaggaatgatgtcaaggccatcgtcttgaccggcaacggtgga
agattctcgggtggtttcgacatcaatgttttccagcaagttcataagactggggatata
tcgcttatgcctgaagtatccattgatcttgtgtccaaccttatggaagactctaggaag
ccgcttgttgctgctgttgaaggattagctcttggtggtggtttagaactggctatggcg
tgtcatgctcgagttgctgccccaaaagctcagctaggcttaccagagctgacacttgga
gttattccaggttttggaggtacgcaacgtcttccaagattagtaggccttgcaaaagca
accgatatgatcctgctttccaagtcgatatcgtcagaggaagggcatatgctgggtctc
gttgatgctttggtgccgcctggagatttgttgaccacgtccaggaagtgggctctagac
attgcacttggacgtaaaccccttttgcgttcactgcacaggaccgacaaaattggttct
ctatctgaagctcgtgctgtgttgaagaatacaagacagctagccaagaagatagctccg
aatatgcctcagcaccatgcttgcattgatgtcattgaagaaggtatcgtccatggagga
tatagtggcgttctcaaggaagcagaagttttcaagcaattagtaatgtcagacactgct
aaggctcttgttcatgttttcttcgcacagcgtgcaacatcaaaggtgcctaatgtaact
gacgttggattgaaaccgaggccgatgaaaaaagttgcagttatcggtggaggtctgatg
ggttctggtatcgctaccgctctacttctaagcaatacaagagttgtgctcaaagaaata
aatccagaataccttcagaaaggactaaaatctgttgaagcaaatctcaaaagcttggtg
tctaggggaaagctgacacaagacaaagcaggaaaggccctctcgttgctcaagggggca
ctcgattacgcagaattcaaagatgtggacatggtcatagaggcagtgattgaaaacatt
gagttgaaacaaaagatattcaaagaaatcgaagagatatgtccaccacattgtattttg
gcgagcaacacatctactatcgacctcaacgtaattggggaaaaaactaactcaaaagat
cgcatagttggcgcacatttcttcagcccggcacatattatgacccttctcgagatagtt
cgtacagagaatacttctgctcaggtgatcctggatctcatggcgcttggaaaggccata
aagaaagtccccgttgtggttggaaactgcataggctttgcagtgaacaggacattcttt
ccgtatacacaaggtgctcatatgttggtcaatctaggtgttgacttgttcagagtcgac
agggttatcacctcttttggcttgccattgggtcctttccagctaggtgatttggctgga
cacgggattggaatggcagttaaggagatatatgccaaggtctatggtgaccgaatgttt
cagtctccattaacagagcttctggttaagagcggacgaaatggcaaaatcaacgggaga
ggatactatatttacgaaaagggaagcaaaccaaagcctgattcatcagtgctttcagtt
gttgaggaatcgaggaaacttaccaatatcatgcccggtgggaagcctatatcagtaact
gataaagaaattgtagagatgatcttgttccctgtggttaacgaagcgtgccgtgtccta
gatgaaggagttgtgatccgagcctcagacttggacgttgcatctgtccttggaatgagt
tttccttcttaccgcgggggaattgttttctgggcagacacggttggacctaagtacata
tatgaaaggctcaagagattgtccgagacttatggaggctttttcaaaccatcgaggtat
ctggaggaaagggcaatgaatggaatgcttctgagtgaacctaaggcgtccaggtctcga
atgtga

DBGET integrated database retrieval system