KEGG   Raphanus sativus (radish): 108856477Help
Entry
108856477         CDS       T06014                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00061  Fatty acid biosynthesis
rsz00780  Biotin metabolism
rsz01100  Metabolic pathways
rsz01212  Fatty acid metabolism
Module
rsz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108856477
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108856477
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    108856477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rsz01004]
    108856477
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     108856477
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     108856477
Lipid biosynthesis proteins [BR:rsz01004]
 Fatty acid synthase
  Component type
   108856477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 108856477
NCBI-ProteinID: XP_018485789
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MAATAASSLQFATIRPSISSKVFKAGTCIVGANPRNASWDKLACTRPLSNLGCLRNNSSL
PTSKKSFSFSTKAMSESSQNNASFGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAE
ILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANK
RYAGSSNWTVQEAAECVRKDFGTIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSF
VSLLRHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNI
RVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPVQKTLTADEVGNAAAFLVSPLASAITG
ATIYVDNGLNSMGVAIDSPVFKDLK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggcagcttcaagcttgcaatttgctacaataaggccaagcatctctagc
aaagtttttaaagcagggacctgcattgtcggtgccaatcccaggaacgcatcatgggac
aaactcgcttgcactcgccctctatcgaacctcggatgtttgagaaacaacagttctctt
ccaacttctaaaaagagtttttccttttcaacaaaggcaatgtctgaatccagccagaac
aacgcttcttttggacttcctattgatttgagagggaaaagagctttcattgctggtatt
gctgatgataatggatatggttgggccatagccaaatctcttgctgctgctggtgctgaa
atattggttgggacatgggttcctgcacttaacatttttgagacgagcctgagacgtgga
aaatttgaccagtcacgcgtgctgcctgacggttcattgatggagattaaaaaggtctat
cctttggatgctgtgtttgacaatcctgaagatgtgcctgaggatgtgaaagcgaataag
cgatatgctggatcatcaaactggacagtacaggaagctgctgaatgtgtgagaaaagat
ttcggaaccattgacattcttgtccactcacttgcaaatggaccagaggttagcaaacct
cttctagagacatcaagaaagggctacctcgctgctatctctgcttcgagttactcgttt
gtttccctcctcaggcatttcctgccaattatgaacccaggaggcgcttctatatctctt
acttacattgcttctgaaaggatcattcctgggtatggtggaggtatgagttctgcgaaa
gccgcactagagagtgatacacgggtgcttgcatttgaagctggaaggaaacaaaacatt
agggtcaacaccatctctgcaggtcctttgggaagccgagcagcaaaagcaattgggttc
atagacaccatgattgagtattcatacaataatgcgcctgttcagaaaacattgaccgca
gatgaagttgggaatgcagcagccttcttggtatctccattggcttctgccataactggt
gcaaccatctatgttgacaatggcttgaattcaatgggtgttgccatcgacagtccagtt
ttcaaagacctcaaatag

DBGET integrated database retrieval system