KEGG   Ramlibacter tataouinensis: Rta_00640Help
Entry
Rta_00640         CDS       T01544                                 

Gene name
gst
Definition
(GenBank) Candidate glutathione S-transferase (Glutathione transferase)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rta_00640 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rta02000]
    Rta_00640 (gst)
Enzymes [BR:rta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rta_00640 (gst)
Transporters [BR:rta02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rta_00640 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_3 GST_N GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEG91124
UniProt: F5Y2F0
LinkDB All DBs
Position
complement(68505..69113)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLREAGLAFEPVLASTKSHKLQDGTDYYGINPLGYVPLLELDDG
TRLREGPAIVQYIADQVPTRNLAPANGTLPRYRLQEWLTFIGTEIHKGFSPLFNPAMPEE
AKKISRDKLVSRLQWVDGQLTGKAFLMGEHFSVADAYLFVVTNWAKPMAIDLAPYKNLLA
FRERMAARPAVQEAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactcccccggcgcctgttccctgtcgccccacatcgtgctgcgcgag
gccgggctggccttcgagccggtgctggccagcaccaagagccacaagctgcaggacggc
acggactactacggcatcaatcccctgggttacgtgccgctgctggagctggacgacggc
acgcggctgcgcgaaggcccggccatcgtgcagtacatcgccgaccaggtgccgaccagg
aacctggcgccggccaacggcacgctgccgcgctaccggctgcaggagtggctgaccttc
atcggcaccgagatccacaagggcttctcgccgctgttcaacccggccatgccggaggag
gccaagaagatctcgcgcgacaagctggtctcgcgcctgcagtgggtggacggccagctg
accggcaaggcctttctgatgggcgagcacttcagcgtggccgatgcctacctgttcgtc
gtgaccaactgggccaagcccatggccatcgacctggcgccctacaagaacctgttggcc
ttccgcgagcgcatggcggcgcggccggcggtgcaggaggcgatgaaggcggagggcctg
ctgaagtag

DBGET integrated database retrieval system