KEGG   Ramlibacter tataouinensis: Rta_06880Help
Entry
Rta_06880         CDS       T01544                                 

Definition
(GenBank) ATP-dependent DNA ligase-like protein
Organism
rta  Ramlibacter tataouinensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase HTH_28
Motif
Other DBs
NCBI-ProteinID: AEG91768
UniProt: F5XX07
LinkDB All DBs
Position
complement(723243..724319)
Genome map
AA seq 358 aa AA seqDB search
MAASTFPVPPIEPMLAKIAEELPQGEGFLFEPKWDGFRALVFRTAEGALIQSRDGKPLNR
YFPELEKMLAEQLPRGCVVDGEVVVAGPGGLDFDALQQRIHPAASRIARLAQETPAGFVA
FDLLAAGGKDITALPQQERRTRLERLLGQARPPLHLTPVTTDRAQAQDWLQRFEGAGLDG
VMAKPADAPYQPGKRAMFKIKHARTADCVVAGFRWYKDKQEAVGSLLLGLYDDAGVLQHV
GITSSFTLAVRKQLLEELGPLREHALENHPWRGWAEAEVGDAERMPGAKSRWSGGKDLSW
EPLRPERVCEVRYDHLQGRRFRHATTFLRWRDDKPPQACRYDQLETSTPFELAQVFGA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcaccttccccgtcccgcccatcgagcccatgctggccaagatcgcggaa
gagctgccgcagggcgagggtttcctgttcgagcccaagtgggacggcttccgggccctg
gtgttccgcacggccgagggcgcgctgatccagagccgcgacggcaagccgctcaaccgc
tacttccccgagctggagaaaatgctggccgagcagctgccgcgcggctgcgtggtcgac
ggcgaggtggtggtcgccggcccgggcggcctggacttcgacgcgctccagcagcgcatc
catcccgccgcctcgcgcatcgcccggctggcccaggaaacgccggccggcttcgtcgcc
ttcgacctgctggcggccggcggcaaggacatcacggccctgccccagcaggagcgccgc
acccggctggagcggctgctcggccaagcccgcccgcccctgcacctcacgcccgtgacc
accgaccgcgcccaggcccaggactggctgcagcgcttcgagggcgccggcctggacggc
gtgatggccaagccggcagacgcgccctaccaacccggcaagcgcgccatgttcaagatc
aaacacgcccgcacggccgactgcgtggtggcgggcttccgctggtacaaggacaagcag
gaggccgtgggctccctgctgctgggcctgtacgacgatgccggcgtgctgcagcacgtg
ggcatcacctcctccttcaccctggccgtgcgcaagcagctgctggaagagctggggccg
ctgcgcgagcacgcgttggagaatcacccttggcgcggctgggccgaggccgaggtcggc
gatgccgaacgcatgcccggcgcgaagagccgctggtccggcggcaaggacctgagctgg
gaaccgctgcgacccgagcgggtgtgcgaggtccggtacgaccacctgcagggccggcgc
ttccgccacgccaccaccttcctgcgctggcgggacgacaagccgccgcaggcctgccgc
tacgaccagctcgagaccagcacgcccttcgagctggcccaggtgttcggcgcctga

DBGET integrated database retrieval system