KEGG   Ramlibacter tataouinensis: Rta_07780Help
Entry
Rta_07780         CDS       T01544                                 

Definition
(GenBank) ATP-dependent DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Rta_07780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rta03400]
    Rta_07780
Enzymes [BR:rta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Rta_07780
DNA repair and recombination proteins [BR:rta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Rta_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AEG91859
UniProt: F5XXQ6
LinkDB All DBs
Position
complement(806427..808886)
Genome map
AA seq 819 aa AA seqDB search
MVQKHWATRLHYDFRLELEGTMKSWAVPKGPSFDPADKRMAMPTEDHPIAYNRFEGTIPP
GNYGAGKVIIWDKGTWVPLEDPHRGWREGKLKFELRGHKLRGHWTLVRMKGRGNGREDPW
LLIKERDELARPAAEFSVVDEMPDSVGHLPDVPEGAASSPAPSSSSAPAADAAVPASVAP
QAAVGGPPAGARPAALPQEMQPQLATLVEGPPEDPQNWIYEIKFDGYRMLARAEGGAVRL
VTRNGNDWTHRLPHLERALVAMELPDGWYDGEIIVPGNGTPADFQSLQGAFESSRTADIV
YHLFDLPYCAGHDLRDVPLEQRRAVLQRVVERRPQPGVRFSAVFDAPPEDIVASACRLGL
EGVIGKRRDSRYVTRRSADWIKLKCARRQEFVIGGFTDPKGSRTGIGSLLLGVHGAQGEL
KYAGNVGTGFNEQSLRQLRERLDALATDTKPFASGAQIPKKAHWVRPELIAEVSFGEWTR
DGRVRHSVFRGLRGDKAPQAITREEAMPAPAAEPAPAPATASVALPAKLRVSHPERVIDA
ASGTTKIQLVRYYALVAPLMMPHLKNRPVSLVRAPQGIGGELFFQKHAERYQMAGIEALD
PALDPDHPPVLEVVRPEGLLSAAQMNVIEFHTWNGVKTAIAKPDRMTFDLDPGEGVQWPQ
VQEAAQLVRAFLGELGLPAFLKTSGGKGLHVVVPLKKQRDWDTVKDFSQAIVQHLARTLP
DRFVAKSGPSNRVGKIFIDYLRNGYGATTVAAWSARSRPGLGISVPVRWEELGALGSGAH
WTVATVHTRLDEGNAPWSDYEAQRAGLSRAMKTLGFQRP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
gtggtccagaagcactgggccacgcggctgcactacgacttccggctggagctggaaggc
accatgaagagctgggccgtgcccaagggccccagcttcgacccggccgacaagcgcatg
gcgatgccgaccgaggaccaccctatcgcctacaaccgcttcgagggcaccatcccgccg
ggcaactatggcgcgggcaaggtcatcatctgggacaagggcacctgggtgccgctggaa
gacccgcaccggggctggcgcgaaggcaagctgaagttcgagctgcgcgggcacaagctg
cgcggccactggacgctggtgcgcatgaagggccgcggcaatggccgcgaggacccctgg
ctgctgatcaaggaacgcgacgagctggcccggccggcggccgagttcagcgtggtcgac
gagatgccggacagcgtgggccacctgcccgacgtgccggagggcgcggcatcctccccg
gcaccgtcctccagctcggcccctgctgcggatgccgcggtgcccgcgtccgtggcgccg
caggcagccgtcggcggaccgcccgccggcgcgcgtcccgcggcgctgccgcaggagatg
cagccgcagctggcgaccctggtcgaggggccgccggaggatccgcagaactggatctac
gagatcaagttcgacggctaccgcatgctcgcgcgcgccgagggcggcgcggtgcgcctc
gtcacccgcaacggcaacgactggacgcaccggctgccgcacctggagcgggccctggtc
gcgatggagctgcccgacggctggtacgacggcgagatcatcgtgccgggcaacggcacc
cccgccgacttccagtcgctgcagggcgccttcgagagctcgcgcacggccgacatcgtc
taccacctgttcgaccttccctattgcgccgggcacgacctgcgcgacgtgccgctggag
cagcgtcgcgcggtgctgcagcgggtggtggaacgccgcccgcagccgggcgtgcgcttt
tccgccgtgttcgacgcgccgcccgaggacatcgtggcctcggcctgccgcctggggctg
gagggcgtgatcggcaagcggcgcgattcccgctacgtcacgcggcgctcggccgactgg
atcaagctcaagtgcgcgcggcgccaggaattcgtcattggcggcttcaccgaccccaag
ggctcgcgcaccggcataggctcgctgctgctgggcgtgcacggtgcccagggcgagctg
aagtacgccggcaacgtgggcaccggcttcaacgagcagagcctgcggcagctgcgcgag
cggctggacgcgctggccaccgacaccaagccgttcgcgtccggcgcgcagatcccgaag
aaggcgcactgggtgcggccggagctgatcgccgaggtgtccttcggcgaatggacgcgc
gacgggcgggtgcggcattcggtgttccgcggcctgcgcggcgacaaggcgccgcaggcg
atcacgcgcgaggaggcgatgccggcacccgcagcggaaccggcacccgcaccggcaacg
gcatccgtcgccctgcccgccaagctgcgcgtcagccacccggagcgggtgatcgacgcc
gccagcggcaccaccaagatccagctggtgcgctactacgccctggtggcgccgctgatg
atgccgcacctgaagaaccggccggtgtctctggtgcgcgcgccccagggcatcggcggc
gagctgttcttccagaagcacgcggagcgctaccagatggcgggcatcgaggcgctggac
ccggccctcgatcccgaccacccgcccgtgctggaagtggtgcggcccgagggcctgctg
tcggcggcgcagatgaacgtcatcgagttccacacctggaacggcgtgaagaccgccatc
gccaagcccgaccgcatgaccttcgacctggacccgggcgaaggcgtgcaatggccgcag
gtgcaggaggcggcgcagctggtgcgcgccttcctcggcgagctggggctgccggccttc
ctcaagaccagcggcggcaaggggctgcacgtggtggtgccgctgaagaagcagcgcgac
tgggacacggtgaaggatttctcgcaggccatcgtgcagcacctggcccgcaccctgccc
gaccgcttcgtcgccaagagcgggcccagcaaccgggtcggcaagatcttcatcgactac
ctgcgcaacggctacggcgccaccacggtggccgcctggtcggcccgctcccggcccggc
ctgggcatctcggtgccggtgcgctgggaggagctgggcgccttgggcagcggcgcgcac
tggaccgtggccacggtgcacacccggctggatgagggcaacgcgccctggtccgactac
gaggcgcagcgcgccggcctgtcgcgcgccatgaagacgctcggcttccagagaccctga

DBGET integrated database retrieval system