KEGG   Ramlibacter tataouinensis: Rta_09720Help
Entry
Rta_09720         CDS       T01544                                 

Gene name
ddlA
Definition
(GenBank) Candidate D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00473  D-Alanine metabolism
rta00550  Peptidoglycan biosynthesis
rta01100  Metabolic pathways
rta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rta_09720 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rta_09720 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Rta_09720 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rta01011]
    Rta_09720 (ddlA)
Enzymes [BR:rta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rta_09720 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:rta01011]
 Precursor biosynthesis
  Amino acid ligase
   Rta_09720 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK TTL ATP-grasp Neuropep_like
Motif
Other DBs
NCBI-ProteinID: AEG92056
UniProt: F5XZM7
LinkDB All DBs
Position
1005232..1006203
Genome map
AA seq 323 aa AA seqDB search
MSGTFNFGKVAVLMGGQSAEREVSLMSGSGVLKALQAKGVDAHAFDPAQRDLSELKREGF
GRCFIALHGRFGEDGTVQGALELLGIPYTGSGVMASSIAIDKVMTKRVWLAEGIPTPKYR
LLRRGAYQRGQVVRIPDELGLPLIVKPAREGSSIGVAKVQGYSEMQGAVDAAAALDADVL
CEQFVSGDEVTCPILGTGDAARALPVIRIVAPAGNYDYQNKYFTDDTQYLVPCGLPAGEE
AAIQALVLKAYRVLGCRGWGRIDVMIDGRTRQPSLLEINTSPGMTGHSLVPMSARAAGIS
YEDLCVQLLASATLDHAKEAAIP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtaccttcaactttggaaaggtggctgtcctgatgggcggccagtcggccgag
cgcgaggtgtcgctcatgtccggcagcggcgtgctcaaggcgctgcaagccaagggcgtg
gacgcgcacgccttcgatccggcgcagcgcgacctgtccgagctcaagcgcgagggcttc
gggcgctgcttcatcgccctgcacggccgcttcggcgaggacggcacggtgcagggcgcg
ctggagctgctgggcatcccctacaccggctcgggcgtgatggcctcgtccatcgccatc
gacaaggtcatgaccaagcgggtctggctggccgagggcatcccgacgccgaagtaccgg
ctgctgcggcgcggcgcctaccagcgcgggcaggtggtccgcatccccgacgagctgggc
ctgccgctgatcgtcaagccggcgcgcgagggctcgtccatcggcgtcgccaaggtccag
ggctattccgagatgcagggggccgtggacgcggccgccgcgctggatgccgacgtgctg
tgcgagcagttcgtctcgggcgacgaggtgacctgcccgatcctgggaacgggcgacgcg
gcgcgcgcgctgcccgtcatccgcatcgtcgcgccggcgggcaactacgactaccagaac
aagtacttcaccgacgacacccagtacctggtgccctgcggcctgccggcgggcgaggag
gcggccatccaggcgctggtgctcaaggcctaccgcgtgctgggctgccgcggctggggc
cgcatcgacgtgatgatcgacggcaggacgcgccagccctcgctgctggagatcaacacc
tcgccgggcatgaccgggcactcgctggtgcccatgtcggcgcgtgccgccggcatcagc
tacgaggacctgtgcgtccagctgctggcctcggccacgctggaccatgccaaggaggcg
gccatcccatga

DBGET integrated database retrieval system