KEGG   Ramlibacter tataouinensis: Rta_24200Help
Entry
Rta_24200         CDS       T01544                                 

Gene name
ahpF
Definition
(GenBank) Candidate alkyl hydroperoxide reductase F component
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rta  Ramlibacter tataouinensis
Brite
KEGG Orthology (KO) [BR:rta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rta_24200 (ahpF)
Enzymes [BR:rta01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Rta_24200 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin DAO FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C FMO-like Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEG93518
UniProt: F5Y1B7
LinkDB All DBs
Position
2569296..2570855
Genome map
AA seq 519 aa AA seqDB search
MLDASLKAQLAAYMERISQPVEITAALDDTPASRDMQALLRDIAETSPLVRVTETQGGPY
RTPSFAINRPGENHGPRFAGLPMGHEFTSLVLALLQVGGYPPKVEQAVLEQIRALEGDFE
FEVYVSLSCHNCPDVVQALNLMAVQNPRIKTTMVEGSLFQQEVEERQIMGVPTVFLNGTL
FDTGRMSLEEILAKIDKGGVEREARKIAQKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFVSVKETEGPKFALALEEHVRHYDVDIMNLQRAKALKPGQDLI
EIELESGAALKARSVIVTTGARWRNINVPGEQEYKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLVEFDTKLRADAVLQRKLASLPNVEVVLNAQTTEITGDGQK
VNGLVYKDRASGESRRVALEGVFVQIGLVPNTDWLKGTVELSRYGEIVVDAKGQTSVPGV
FAAGDATTVPFKQIIIAAGEGAKAALSAFDHLIRTSAPA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcctcaaagcccagcttgccgcttacatggagcgcatctcgcagccg
gtggagatcaccgccgcgctggacgacacccctgcctcgcgcgacatgcaggcgctgctc
agggacattgccgagacctcgccgctggtgcgcgtgaccgaaacccaaggcggcccctac
cgcaccccgtcgttcgctatcaaccgcccgggcgagaaccacggcccgcgctttgccggc
ctgcccatggggcacgagttcacctcgctggtgctggcgctgctgcaggtcggcggctac
ccgcccaaggtcgaacaggccgtgctggagcagatccgcgcgctggaaggcgacttcgag
ttcgaggtctacgtctccctgtcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgcagaacccgcgcatcaagaccaccatggtcgaaggcagcctgttccag
caggaggtcgaggagcgccagatcatgggcgtgcccacggtgttcctcaacggcaccctg
ttcgacaccggccgcatgagcctggaggagatcctggccaagatcgacaagggcggcgtc
gagcgcgaagccaggaagatcgcccagaaggacccgttcgacgtgctgatcgtcggcggc
gggccggccggcgcggcggcggcggtctacgccgcgcgcaagggcatccgcaccggcgtg
gcgtccgagcgcttcggcggccaggtgctggacaccctgggcatcgagaacttcgtctcg
gtcaaggagaccgaggggccgaagttcgcgctggcgctggaggagcacgtgcgccactac
gacgtggacatcatgaacctgcagcgggccaaggcgctcaagccgggccaggacctgatc
gaaatcgagttggagagcggcgccgcgctcaaggccaggagcgtgatcgtgaccaccggc
gcgcgctggcgcaacatcaacgtgcccggcgagcaggagtacaagaacaagggcgtggcc
tactgcccgcattgcgacggcccgctgttcaagggcaagcgggtggccgtgatcggcggc
ggcaactccggcgtggaggccgcgatcgacctggccggcatcgtcggccacgtgaccctg
gtcgagttcgacaccaagctgcgcgccgacgcggtgctgcagcgcaagcttgccagcctg
cccaacgtggaggtggtgctgaacgcgcagaccaccgagatcaccggcgacggccagaag
gtcaacgggctggtctacaaggaccgcgcctccggcgagagccggcgcgtggcgctggaa
ggcgtgttcgtgcagatcggcctggtgcccaacaccgactggctcaagggcacggtggag
ctctcgcgctacggcgagatcgtggtcgacgccaagggccagacctcggtgcccggcgtg
ttcgctgcgggcgacgccaccaccgtgccgttcaagcagatcatcatcgcggccggcgaa
ggcgcgaaggcggcgctgagcgccttcgatcacctcatccgaaccagcgcgccggcgtga

DBGET integrated database retrieval system