KEGG   Ramlibacter tataouinensis: Rta_27310Help
Entry
Rta_27310         CDS       T01544                                 

Definition
(GenBank) threonine dehydrogenase and related Zn-dependent dehydrogenase-like protein
Organism
rta  Ramlibacter tataouinensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DAO ApbA Shikimate_DH NAD_binding_8 Pyr_redox_2 Pyr_redox_3 HI0933_like AlaDh_PNT_C FAD_binding_3 ThiF FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEG93833
UniProt: F5Y4I6
LinkDB All DBs
Position
2904980..2905996
Genome map
AA seq 338 aa AA seqDB search
MKALVYTAPRTLQLQELPPPSPEAGSVRVRVEAVGICGSDLHAWHGHDPRRVPPLVLGHE
FAGTVLEGPLAGCRVTANPLVVCGQCRYCRQGRGNLCAHRRMIGMNIAGAFAEELSVPEQ
CLIELPPGLDACAAALAEPAATVLHAFALAARSLAQPLPQARVLVIGAGAIGLLAALHLQ
SHGGAAAAVLEANPLRRQRALQATGIEVRDPRQEPPAEAGADLVFDAVGSAATRTMALHA
VAPGGTVVHVGLADGASEIDMRKLTLAEVTLAGSYTYTGADLRAAVRALAAGRFGDLSWV
DERPLDEGPQAFADMAAGRVGAAKILLRPRREQGAGRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctggtctacacggcgccccgcacgctgcagctgcaggagctgccccctccc
tcgccggaggccgggtcggtgcgggtgcgcgtcgaggcggtgggcatctgcggctcggac
ctgcacgcctggcacgggcacgacccgcggcgggtgccgccgctggtgctgggccacgag
ttcgcgggcacggtgctggaaggtcccctggccgggtgccgcgtcacggccaacccgctg
gtggtctgtggccagtgccgctactgccgccagggccggggcaacctgtgcgcccaccgg
cggatgatcggcatgaacatcgcgggcgcgttcgccgaggagctgtccgtgcccgagcag
tgcctgatcgaactgccgccgggcctggacgcgtgcgccgccgcactggccgagccggcc
gccaccgtgctgcatgcgttcgcgctggccgcccgctcgctggcgcagccgctgccgcag
gcgcgggtgctggtcatcggcgcgggcgcgatcgggctgctggcggcgctgcacctgcag
tcgcatggtggtgccgccgcggcggtgctggaggccaacccgctgcgccggcagcgcgcc
ctgcaggccaccggcatcgaggtgcgcgacccgcggcaagagcctcccgccgaggccggc
gccgacctggtcttcgatgccgtgggcagcgccgccacccggacgatggcgctgcacgcg
gtggcgccgggcgggaccgtggtccatgtcggcctggccgatggggccagcgagatcgac
atgcgcaagctcaccctggccgaggtcacgctcgcgggcagctacacctacaccggggcc
gacctgcgcgcggccgtgcgggcgctggcggcaggccggttcggcgatctctcatgggtc
gacgagcggccgctggacgagggcccccaggcgttcgccgacatggccgccggccgggtc
ggcgccgccaagatactgctgcggccccgccgcgagcagggcgcaggccgctcatga

DBGET integrated database retrieval system