KEGG   Ramlibacter tataouinensis: Rta_36220Help
Entry
Rta_36220         CDS       T01544                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase-like protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00564  Glycerophospholipid metabolism
rta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rta_36220
Enzymes [BR:rta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rta_36220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox_3 FAD_binding_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AEG94737
UniProt: F5Y1F3
LinkDB All DBs
Position
complement(3852804..3854381)
Genome map
AA seq 525 aa AA seqDB search
MQRQQLLAELARPKKYDLAIIGGGATGLGVALDAAARGFSAVLIESHDFASGTSSRATKM
VHGGVRYLAQGNVSLVREALHERGTLLRNAPHLAQPLPFVMPSYRLWETPFYGAGLKLYD
VLAGRAGLGSTEFLGRGETLGLLPTLRPEGLKGGVKYWDGQFDDARLALALARTAAARGA
LLVNYCEAAGLVYEDGKVAGLRCRDRESGREFPLAARCVINAAGVWVDELRRQDGEATGR
AARPMVAPSQGVHLVVDRDFLPGDHALMVPKTADGRVLFGVPWLGKLILGTTDTPRDDLA
REPTPFGHELDFILGEAGRYLRRAPRREDVRSIWVGLRPLVKPQGDDGEDTKSLSREHTV
LVSRSGLVTVTGGKWTTYRAMAEDVLERCFAERLLDRAVAGVTADLPLVGADVAPAACRP
LSAPPGLHLYGSEADEVAALPGARHELGGGLSEAMVRFAARREYARTVEDVLARRQRLLF
LDAGLAASLAPAVGELLRQETGADPQVQAFERVAQAYQGLPNPGV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacagcagctgctcgccgaactggcccggcccaagaaatacgacctggccatc
atcggcggcggcgccaccgggctgggggtggcgctggatgccgccgcgcggggcttctcg
gcggtgctgatcgagtcgcacgatttcgccagcggcacctcctcgcgcgccaccaagatg
gtgcacggcggcgtgcgctacctggcgcagggcaatgtctcgctggtgcgcgaggccctg
cacgagcgcggcacgctgctgcgcaacgcgccgcacctggcgcagccgctgcccttcgtc
atgccgtcctaccggctgtgggagacgccgttctacggcgccgggctcaagctctacgac
gtgctggccggccgggccggcctgggctcgaccgagttcctgggccgcggcgagacgctg
ggcctgctgcccaccctgcggcccgagggcctcaagggcggcgtgaagtactgggacggc
cagttcgacgacgcgcgcctggccctggccctggcgcgcaccgcggccgcccgcggcgcg
ctgctggtcaattactgcgaagccgccggcctggtctacgaggacggcaaggtggccggc
ctgcgctgccgcgaccgcgagagcggccgcgagttcccgctggccgcccgctgcgtgatc
aatgcggcgggtgtctgggtggacgagctgcggcgccaggacggcgaggccaccggccgg
gcggcgcgccccatggtggcgcccagccagggcgtgcacctggtggtggaccgcgacttc
ctgcccggcgaccacgcgctgatggtgcccaagaccgcggacggccgggtgctgttcggc
gtgccctggctgggcaagctgatcctgggcaccaccgacacgccgcgcgacgacctggcg
cgcgagccgaccccgttcggccacgaactggacttcatcctcggcgaggccggccgctat
ctgcgccgggcgccgcggcgcgaggacgtgcgcagcatctgggtgggcctgcgccccctg
gtcaagccgcagggcgacgacggcgaggacaccaagagcctgagccgcgagcacaccgtg
ctggtcagccgctccggcctggtcaccgtgaccgggggcaagtggacgacctaccgcgcc
atggccgaggacgtgctggaacgctgctttgccgaacggctgctggaccgggccgttgcc
ggggtgacggctgacttgcccctggtcggggccgacgtggcgccggccgcctgccgcccc
ctgagcgcgccgccgggcctgcacctgtacggcagcgaagccgacgaggtggccgcgctg
cccggcgcccgtcatgaactgggcggcggcctgagcgaggccatggtccgcttcgccgcc
cgccgtgaatacgcgcggaccgtggaagacgtgctggcgcggcgccagcggctgctgttc
ctcgatgccgggctggccgcctcgctggcgccggcggtcggcgagctgctgcggcaggag
accggggccgacccccaggtgcaggccttcgagcgcgtggcccaggcctaccagggcctg
ccgaacccgggggtttga

DBGET integrated database retrieval system