KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_00580Help
Entry
RTB9991CWPP_00580 CDS       T01810                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00020  Citrate cycle (TCA cycle)
rtb00190  Oxidative phosphorylation
rtb00650  Butanoate metabolism
rtb01100  Metabolic pathways
rtb01110  Biosynthesis of secondary metabolites
rtb01120  Microbial metabolism in diverse environments
rtb01130  Biosynthesis of antibiotics
rtb01200  Carbon metabolism
Module
rtb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTB9991CWPP_00580 (sdhA)
   00650 Butanoate metabolism
    RTB9991CWPP_00580 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RTB9991CWPP_00580 (sdhA)
Enzymes [BR:rtb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RTB9991CWPP_00580 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RTB9991CWPP_00580 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFE54821
LinkDB All DBs
Position
151404..153194
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKIFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEDGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFIEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMVIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEYKDHVFLHLNHLSPEILHRRLPGISETAKIFAGVDVTKDPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSIVNGIMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPVSPHKPLKKEILEKIINRFDKIRHANGNVLVADLRLQMQRTMQSHVSVFRTQ
ELLDEGARMISEIRNRYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDIDWIKHTLSSIDDSGQIILDYKPVTLTTLTDEISTIPPVKRIY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatataattcatcataaatttgatgtagtagttgtaggtgcaggt
ggagctggtctgcgttctgcattcggtatggctaaagaagggctgaatactgcttgtata
actaagatatttccaacacgcagtcatactgtggctgcacaaggtggtattagtgctgct
cttggaaatatgggtgaagatgattggcgttggcatatgtatgatactgtaaaaggatct
gattggttaggtgatcaggatgctatcgagtatatgtgtaagaacgctcctgatgctatt
ttagagttagagcattatggtgtgcctttttcaagaactgaagatgggaaaatttatcaa
cgtccttttggtggtatgactacggaatatggtaaagggaaagcggctcagcgtacatgt
gctgccgcagatcgtactgggcatgccatactgcatactttatatcagcaatcactaaaa
cataaagtgcagttttttattgaatattttgctattgatttattaatggaagatggtgaa
tgtagaggtgtagttgcttggaatttagatgatggtagtcttcattgttttagagcgcat
aatgtagtgcttgcaacgggtggatacgggcgtgcttatttttctgcgacttctgctcat
acttgtacgggtgatggaggtggtatggtgattagagctggtcttccattgcaagatatg
gaatttgtacaatttcatccgactggtatatattcggctggttgtcttattactgaagga
gctagaggtgagggagggtatctcgttaatgcaaacggtgagcgttttatggagcgttat
gcacctgctgcaaaagatttagcttcaagagatgtagtgtcaagagcaatgacgatagaa
atcagagagggtagaggagttggtgagtataaagatcatgtatttttacatttaaatcat
ttatcgcctgaaattttacatagacgtttaccaggtatctctgaaactgctaaaattttt
gctggtgttgatgtaactaaagatccgataccagtacttcctacagtacattataacatg
ggcgggataccgactaattatcatgggcaagtcataatcaaagacggcaaaaatcataat
agtatagtcaatggaattatggcaatcggtgaagcagcttgtgtatcagtacatggtgct
aaccgattaggatcaaattctttacttgatctagtagtattcggtagaagctctgcatta
aaggcggctgagcttataaagccagtaagccctcataagcctttaaaaaaagaaattctt
gaaaaaattataaatagatttgataaaattcgtcacgctaacggcaatgttttagttgca
gatttaaggcttcaaatgcaaagaactatgcaaagccatgtttcagtatttagaactcaa
gagttactagatgaaggagcaagaatgattagtgaaatcagaaatagatataaagatata
aaaattaatgataaatctttaatttggaatagtgatttagtagaagctttagaactagat
aatctacttgatcaggccttagtaacagtatattcagcagctgcaagaaaagaaagcaga
ggtgcacatgcacgcgaagattatcctgatcgtaatgatatagattggattaagcatact
cttagctctattgatgattcaggtcaaatcattcttgattataaacctgtaacattaaca
actttaaccgatgaaattagtacaattccaccagtgaagaggatttattaa

DBGET integrated database retrieval system