KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_04000Help
Entry
RTB9991CWPP_04000 CDS       T01810                                 

Definition
(GenBank) DNA polymerase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:rtb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    RTB9991CWPP_04000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rtb03400]
    RTB9991CWPP_04000
Enzymes [BR:rtb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     RTB9991CWPP_04000
DNA repair and recombination proteins [BR:rtb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     RTB9991CWPP_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AFE55503
LinkDB All DBs
Position
complement(1065914..1066690)
Genome map
AA seq 258 aa AA seqDB search
MNDIFKWLNAIGVEYYCYEHTPQKIPNNTELTEKQQVELMHTTEAACNNNVHDNITLSRS
LADKANNIAELRESLLNFNGCELKKFATNTVFGDGNPQAKIMLIGEAPGNTEDLKGIPFC
GESGNLLDNMLYAIGISRKNNFYITNMVFWRPPANRQPTLEEVDICRPFVEKHIALINPK
LLILVGSTAATSLLGKNSCITKIRQEYYFYTNKYISTPIQTTAIFHPAYLLRQPMQKRTS
WYDLLKIKEYLVNNRVIA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatatttttaaatggttaaatgcaatcggtgttgaatattattgctacgaacac
acaccacaaaaaatacctaataatactgaactcactgaaaagcaacaagtagaacttatg
catacaacagaagcggcatgtaataataatgttcatgataatatcactttatcaagatct
cttgcagataaagctaataatatcgcagaactacgagaatctctactaaattttaatggt
tgcgaacttaagaaatttgctactaatacagttttcggtgatggtaatccacaagctaaa
attatgttaataggtgaagctccagggaatactgaagatttaaaagggatacctttttgt
ggtgaaagtggtaatttacttgataatatgttgtatgctatagggatttcacggaaaaat
aatttttatattactaatatggtattttggcgtcctcctgctaatagacaaccgactctg
gaagaagttgatatttgtagaccttttgtagaaaaacatattgccctaattaatcctaag
ttacttattctagttggtagcactgctgcaactagtttacttggaaaaaattcatgtatt
actaaaattagacaagaatattacttttatacaaataaatatatatcaactcctattcaa
actactgcaatctttcaccctgcatatttactgagacaacctatgcaaaaacgcacctcc
tggtatgatctactaaagattaaggaatatttagtgaataatagagttattgcataa

DBGET integrated database retrieval system