KEGG   Rathayibacter toxicus WAC3373: APU90_08045Help
Entry
APU90_08045       CDS       T04269                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rtc  Rathayibacter toxicus WAC3373
Pathway
rtc00020  Citrate cycle (TCA cycle)
rtc00190  Oxidative phosphorylation
rtc00650  Butanoate metabolism
rtc01100  Metabolic pathways
rtc01110  Biosynthesis of secondary metabolites
rtc01120  Microbial metabolism in diverse environments
rtc01130  Biosynthesis of antibiotics
rtc01200  Carbon metabolism
Module
rtc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APU90_08045
   00650 Butanoate metabolism
    APU90_08045
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    APU90_08045
Enzymes [BR:rtc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     APU90_08045
    1.3.5.4  fumarate reductase (quinol)
     APU90_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_4 Fer4_18 Fer4_20 Fer4_15 Fer4_2 Fer4_21 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ALS57723
UniProt: A0A0C5BG54
LinkDB All DBs
Position
complement(1744565..1745326)
Genome map
AA seq 253 aa AA seqDB search
MSTATIAERPAGPAAPEAFTVTFVIRRYNPEADTEPRWQDFDVEMYSTDRVLDALHRIKW
EQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDISQPIYIEAIKGLPLEKDLV
VDMEPFFASYREVQPFLIATTPAPQGKERIQSASDRARFDDTTKCILCAACTSSCPVFWT
DGQYFGPAAIVNAHRFIFDSRDDAGGTRLDILNDKEGVWRCRTTFNCTEACPRGIQITQA
IAEVKQAVIRGRV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgccaccatcgccgaacggcccgctggccccgcggcacccgaagcctttacc
gtcaccttcgtcatccgccgctataaccctgaggccgataccgagccgcgctggcaagac
tttgacgtcgagatgtattcgaccgaccgcgtcctcgatgcgctgcaccgcattaagtgg
gagcaggacggctcgttgaccttccgccgttcctgcgctcacggcatctgtggctccgac
gccatgcgtatcaatgggcgtaaccgtctggcatgtaagacgctgattaaagacctcgac
atttcgcagccaatttacattgaggccattaagggattaccgctcgaaaaagacttggtc
gtcgatatggagcctttcttcgcctcataccgcgaagtgcagccctttttaattgctact
actcccgcaccgcagggcaaggaacgcatccagtcggcgtccgaccgtgcccgctttgac
gacaccaccaagtgcattctttgtgccgcctgcacctcgtcgtgtcccgtgttttggacc
gatgggcaatacttcggccccgccgcgatcgtgaatgcgcatcgcttcattttcgactcg
cgcgatgacgcgggcggcacccgtctcgacatcctcaacgacaaggaaggcgtgtggcgc
tgccggacgaccttcaactgtacggaggcgtgcccgcgcggcatccagatcacccaggcc
attgccgaggtcaagcaggctgtgatccgcggtcgcgtctga

DBGET integrated database retrieval system