KEGG   Rathayibacter toxicus WAC3373: APU90_08050Help
Entry
APU90_08050       CDS       T04269                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rtc  Rathayibacter toxicus WAC3373
Pathway
rtc00020  Citrate cycle (TCA cycle)
rtc00190  Oxidative phosphorylation
rtc00650  Butanoate metabolism
rtc01100  Metabolic pathways
rtc01110  Biosynthesis of secondary metabolites
rtc01120  Microbial metabolism in diverse environments
rtc01130  Biosynthesis of antibiotics
rtc01200  Carbon metabolism
Module
rtc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APU90_08050
   00650 Butanoate metabolism
    APU90_08050
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    APU90_08050
Enzymes [BR:rtc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     APU90_08050
    1.3.5.4  fumarate reductase (quinol)
     APU90_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like DAO Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ALS57724
UniProt: A0A0C5BB17
LinkDB All DBs
Position
complement(1745329..1747161)
Genome map
AA seq 610 aa AA seqDB search
MSTAGNTYGVEQSASDHTVGPDGVHYHRFDVVIVGAGGAGMRAAIEAGPKAKTAVLSKLY
PTRSHTGAAQGGMAAALANVEEDSWEWHTFDTVKGGDYLVDQDAAEILAKEAIDAVIDLE
NMGLPFNRTGEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLFQNCVKLGINF
YNEFYVLDLVMTEVDGVHKPSGVVAYELATGELHVFQAKAIVFATGGFGKIYKTTSNAHT
LTGDGVGIIWRKGLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYA
PTIKDLAPRDIVARCMVQEVTEGRGAGPHKDHVLLDCTHLGAEVLETKLPDITEFARTYL
GVDPVVEPVPVMPTAHYAMGGIPTNVKAEVLSDNTTVVPGLYAAGECACVSVHGSNRLGT
NSLLDINVFGKRSGNNAADYAATVDFTPLPTDPAGPVREMLTSLRNATGTERIAAIRKEL
QDEMDKNAQVFRTDESLEAVTGTIQRLRDRFRNISVHDKGRRFNTDLLEAVELGFLLDLA
EVVVYSARNRKESRGGHMRDDYPQRDDENYMQHTMAYLSGDAHSSDAGDHIRLDWKPVVI
TRYQPMERKY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagcaggtaacacctacggcgttgaacagagcgcctccgaccacaccgtcgga
ccagacggcgtccattatcaccggttcgatgtggtgatcgtcggtgccggcggcgccgga
atgcgagcggctatcgaggccgggcccaaggcgaaaactgccgtgctctccaagctttat
ccgacacgctcacacaccggcgccgcacagggcggcatggctgccgccctcgccaatgtc
gaggaggacagctgggaatggcacacctttgacaccgtcaaaggcggcgactatctcgtc
gatcaagacgcggccgaaattctcgccaaagaggcgatcgatgctgttatcgacctagaa
aacatgggcctgcccttcaaccgcaccggcgagggcagaattgatcagcgtcgcttcggc
ggacacacccgcgatcacggcaaggcacccgttcgtcgggcctgctacgcggccgaccgt
accggccacatgatcctgcaaacactgttccaaaactgcgtcaaactcgggatcaatttc
tacaacgagttttatgtgctcgatctggtgatgacggaggtcgacggcgttcacaagccc
tcaggcgtcgtcgcctacgagctagcaaccggcgagctgcacgtgttccaggccaaagca
atcgtcttcgcgacaggcggcttcggcaagatctacaagaccacgtccaacgcgcacacc
ctcaccggcgacggcgtgggtatcatctggcgcaagggtctgccgctagaggacatggag
tttttccaattccaccccaccggacttgcgggcttaggcatcctgctgacagagggtgcg
cgcggagagggcgcgatcctgcgcaatgcctccggtgagcgtttcatggagcgttatgcc
cccacgatcaaagacctggcgccgcgcgacatcgtcgcccgctgcatggtgcaggaggtg
acggaggggcgcggggccggcccacataaagaccacgtcctgctcgactgcacccatctg
ggcgcggaggtgctcgaaaccaagctccctgatatcacggagttcgcgcgcacctatttg
ggcgtcgatccggtcgtcgagcccgttcccgtgatgcctaccgcgcactacgcgatggga
ggcatcccgaccaacgtgaaggcggaggtgctctcagacaatacgacggtcgtccccggt
ctctatgcggcgggtgagtgcgcgtgtgtatcggtacacggctcgaaccgtttgggcacc
aattcgcttctggatatcaatgtcttcggcaagcgcagcggcaacaacgccgccgactac
gcggcaacggtggacttcaccccgctgccgaccgacccggccggaccggtccgggagatg
cttacctcgctccgaaacgccaccggaaccgagcggattgccgcgatccgcaaggagctg
caagacgaaatggataaaaacgcgcaggtgtttcgcaccgacgagtcattggaggcagtc
accggtacgatccagcgcctccgcgaccgtttccgcaacatttcggtgcacgacaaaggc
agacgctttaacaccgatctactcgaggcggtcgaattgggctttttgctcgacttggcc
gaggtggtcgtttattccgctcggaaccgcaaagaaagtcgcggcgggcatatgcgcgat
gattatccccagcgcgacgatgagaactatatgcagcacaccatggcgtacctctccggc
gacgcccactcctccgatgccggagaccacatccggctcgactggaagcccgtcgtgatc
actcggtaccagccgatggagaggaagtactaa

DBGET integrated database retrieval system