KEGG   Raoultella terrigena: NCTC13098_00368Help
Entry
NCTC13098_00368   CDS       T06046                                 

Definition
(GenBank) Predicted membrane protein
  KO
K08993  putative membrane protein
Organism
rtg  Raoultella terrigena
Brite
KEGG Orthology (KO) [BR:rtg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NCTC13098_00368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1145 Cytochrom_C_asm EutH
Motif
Other DBs
NCBI-ProteinID: VDR24091
UniProt: A0A1V2BMY7
LinkDB All DBs
Position
1:complement(315280..315558)
Genome map
AA seq 92 aa AA seqDB search
MLINLGRVLMLCVWAFLLLNLFQPFPKPLNIFVNVALIFMILMHGLQLTLLKATQPKDAP
PLGRFEQVRIFVFGVFELVAWQKKLKATLRKK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaatctgggccgggtactgatgctgtgcgtatgggcctttttgctcttaaac
ctgtttcagcctttccctaagccgctgaatattttcgtcaacgttgcgcttatctttatg
atcctgatgcacggcctgcagctgacgctgctgaaggccactcagccgaaagatgcgccg
ccgctgggccgcttcgagcaggtgcgcatttttgtcttcggcgtattcgagctggttgcc
tggcagaaaaagctcaaggccacgctgcgtaagaagtga

DBGET integrated database retrieval system