Raoultella terrigena: NCTC13098_04673 Help Entry NCTC13098_04673   CDS       T06046                                  Symbol arsC_3 Name (GenBank) Arsenate reductase   KO K00537   arsenate reductase (glutaredoxin) [EC:1.20.4.1] Organism rtg  Raoultella terrigena Brite KEGG Orthology (KO) [BR:rtg00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NCTC13098_04673 (arsC_3) Enzymes [BR:rtg01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.1  arsenate reductase (glutathione/glutaredoxin)      NCTC13098_04673 (arsC_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ArsC Motif Other DBs NCBI-ProteinID:  VDR28290 UniProt:  A0A3P8M1T7 LinkDB All DBs Position 1:complement(3874917..3875099) Genome browser AA seq 60 aa AA seqDB search MIRNSGNEPTIIYYLDTPPTRDELIKLISDMELRLRALLRKNVEPYEHLGLDEENSVMSS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgatccgtaacagcggtaacgaaccgaccattatttattatctcgatacgccaccgacc cgtgatgagctgattaaacttatttcagatatggaattacggttgcgtgcattgctgcgt aagaatgttgagccttatgaacacctgggccttgatgaagagaattcagtgatgagcagt tga

DBGET integrated database retrieval system