KEGG   Raoultella terrigena: NCTC13098_05384Help
Entry
NCTC13098_05384   CDS       T06046                                 

Gene name
ahpF_2
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rtg  Raoultella terrigena
Brite
KEGG Orthology (KO) [BR:rtg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC13098_05384 (ahpF_2)
Enzymes [BR:rtg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC13098_05384 (ahpF_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_3 FAD_oxidored Pyr_redox_2 Glutaredoxin GIDA Thi4 NAD_binding_8 FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: VDR28981
UniProt: A0A3P8KPI7
LinkDB All DBs
Position
1:complement(4476784..4477701)
Genome map
AA seq 305 aa AA seqDB search
MLDVNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNTLAV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDLE
FETYYSLTCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVKGKE
FGQGRMTLAEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNEYDVDVIDSQSASKLVPAAGRR
RPASD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgtaaacatgaaaacccagctcagggcctaccttgagaaactgactaagcct
gttgagctgattgctacgctggacgacagcgctaaatcggcagaaatcaaagaactgctg
gcagaaatcgccgagctgtctgagaaagtgacgtttaaagaagacaacacgctcgccgtg
cgcaaaccgtctttcctgattacgaatccaggttctacccaggggccgcgctttgccggc
tctccgctggggcacgagtttacctctctggttctggcgctgctgtggaccggcggccat
ccgtcgaaagaggcccaggccctgctggaacagatccgcgacctcgacggtgatttggag
tttgaaacctactactcgctcacctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcggtcctgaacccgcgtattaagcatacggcgattgacggcgggacgttccag
aatgagattaccgatcgtaacgtgatgggcgttccggcggtctttgtcaaaggcaaggag
tttggccagggacgcatgacgctggcggagatcgtcgcgaaagttgataccggcgcggag
aaacgtgccgcggaagagctgaacaagcgcgacgcttacgacgtgctgatcgtcggctcc
ggcccgtccggcgcggcggcggcggtttactcggcgcgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggccaggtgctggataccgtggatatcgaaaactacatttcg
gtaccgaaaaccgaaggtcagaagctggccggggcgctgaaggctcacgtcaatgagtat
gatgtggacgtcattgactcccagagcgcgtcgaaactggttccggcggcgggtagaagg
cggcctgcatcagattga

DBGET integrated database retrieval system