KEGG   Rufibacter tibetensis: DC20_03625Help
Entry
DC20_03625        CDS       T04099                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
rti  Rufibacter tibetensis
Pathway
rti00052  Galactose metabolism
rti00511  Other glycan degradation
rti00600  Sphingolipid metabolism
rti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DC20_03625
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    DC20_03625
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DC20_03625
Enzymes [BR:rti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DC20_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 DUF1425 Big_1 DNA_pol3_beta
Motif
Other DBs
NCBI-ProteinID: ALI98235
UniProt: A0A0P0CSU6
LinkDB All DBs
Position
complement(938006..940468)
Genome map
AA seq 820 aa AA seqDB search
MQKTNTPYLPIGFSWAVAFLLLLSASSCKTSNVAVRERSDFTKNWSFALGENAGAKDANF
NDTQWRKLSLPHDWSIEGKFDKKHPASYNGGALPGGTGWYRKAFTLDAKDKDKLFYIDFD
GVYTNSEVWVNGQYLGKRPNGYISFRYDLTPYLKFGKEQNVVAVKVDNSQQPNSRWYSGS
GIYRNVWLVKTNPVHVEQWGTFVTTPQVSEQSASVAITTNIRNARQQGGNITLRTLVYDA
QGKEVAKASSENVALKSGQANALTEVKQNLTVSNPTVWSVEQPYLYRVVTLVEQKGKVVD
NYETPLGIRTFNFDVQKGFTLNGKSMKINGVCNHHDLGALGAAVNVRALERQLEILKAMG
VNGIRTSHNPPTPELLDLCDKMGFIVMDESFDMWKKEKTKFDYSHDWDEWHKRDLKDFIK
RDRNHPSVFIWSVGNEIPEQWAPEGTTIAKELVDIVKSLDTTRPVTVGINEPTPNNTIYK
SGALDLFGFNYHHQDFEKFPQTFPGQKFIATETVSALMTRGHYDMPADSIRRWPKRWDIP
FHDGNKDLTVSAYDNVSTPWGSTHEETWKVIKKHAYLSGQYIWTGFDYLGEPTPYVWPAR
SSYFGIVDLAGFPKDVYYMYQSEWTNKPVLHVFPHWNWLPGKTVDVKAYYNNADEVELFL
NGKSQGIKKKQGDDLHVLWRVPFQPGTLRAVSRANGKEVLTKEVKTAGDPAKIVLEADRT
QLSADGKDLSFVTVKILDKDGNLVPTANNLVNFTLDGKATIAGVDNGLQTSLESFKASHR
KAFNGLALAILQAQEEAGTVKLTATSEGLAPATVTIQLKK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaacgaatactccttatctccccatcggcttttcatgggccgttgctttccta
ttgcttttaagtgcttcttcctgtaaaacctccaacgtggcggtgcgggaacgttccgat
tttacaaagaactggtcctttgccctcggcgaaaatgccggagccaaagatgccaatttc
aatgacacccaatggcgtaaactaagcctgccgcatgactggagcattgaaggcaagttt
gataagaagcacccggccagctacaacggtggcgcattacccggcggcaccggctggtac
cgcaaagccttcaccctagacgcgaaagacaaagacaagctcttttacattgactttgac
ggcgtgtacaccaactctgaagtttgggtaaatggccagtatttgggcaaacgacccaat
ggctatatctccttccggtatgatctaacaccttacctcaagtttgggaaggagcagaac
gtagtggccgtaaaagtagacaactcccaacaacccaattcccgctggtattctgggtct
ggcatttaccgcaacgtatggctggtgaaaaccaatccggtgcacgtagaacagtggggc
acgtttgtgactaccccgcaggtgtcagagcaatctgcttcagtggccattactactaac
atcagaaatgcccggcagcagggagggaacatcacgctgcgtacgctggtgtatgatgcc
cagggcaaagaagtggcgaaggcttcttctgagaatgtagctttaaaatccggccaagcc
aatgcgctcaccgaagtaaagcagaacttaactgtcagcaaccctacggtgtggtcagtg
gagcagccgtacctgtaccgggtggtgacgctggtagagcaaaaaggaaaagtggtggac
aactacgagacgccgctgggcattaggaccttcaactttgacgtgcagaaaggttttacc
ctgaacggcaaatccatgaaaattaatggcgtgtgcaaccaccatgacctgggtgcgctg
ggtgccgccgtgaacgtgcgggccttggagcgccaattggaaatcctgaaggccatgggc
gtaaacggcatccggacctcgcacaacccgcccacgcctgagctgctggacctatgcgac
aaaatgggcttcattgtcatggacgagtcttttgacatgtggaagaaagagaaaaccaag
tttgactatagccatgactgggacgagtggcacaaacgcgacctaaaagatttcatcaag
cgcgaccgcaaccaccccagcgtctttatctggagcgtcgggaacgagataccggagcag
tgggcaccggaaggaacaactattgcgaaggagttggtagacattgtgaagagcctggat
actacccgccctgttacggtgggcataaatgagccaacccctaacaacaccatctacaaa
tcaggcgcgctggatctgtttggcttcaactaccaccaccaggactttgagaagtttccg
cagaccttcccgggtcagaaattcatcgctaccgaaactgtctctgcgttgatgacccgc
gggcattatgacatgccggcagacagcatccgtcggtggcccaaacgctgggacattcct
ttccacgacggaaacaaagacctcaccgtctcggcgtatgacaacgtgagcaccccttgg
ggttctacccacgaggagacctggaaagtaatcaaaaagcacgcttacttatcggggcag
tacatctggaccggttttgattacctgggcgaacctaccccatacgtttggccagcccgc
agctcgtacttcgggattgtagatttggccggcttcccgaaagacgtgtactacatgtac
caaagcgaatggacaaacaaacccgtgttgcacgtgttcccgcactggaactggctacct
ggcaaaaccgtggatgttaaggcttattacaacaacgccgatgaggtggagcttttcctg
aacggcaagtcacagggcatcaagaaaaagcaaggcgatgacctgcatgtgctctggcga
gtgccgtttcagccgggtaccctaagagccgtgtcccgcgcaaacggcaaagaagtactc
accaaggaagtcaaaactgccggtgatcccgccaaaattgtgttggaagccgaccgtacc
caactctctgccgatggcaaagacctgtctttcgtgacggtgaagatcctagacaaagac
ggcaacctggtacccaccgccaataacttggtcaatttcacccttgacggcaaagcgacc
atcgcgggtgtggacaacggcttgcagaccagcttggagtcttttaaagccagccatcgc
aaagcgttcaatggcttggcgctggccattctgcaggcccaggaagaagccggcacggtg
aaactgaccgccacatctgaaggtctggctccggccaccgtgaccattcaactgaaaaag
taa

DBGET integrated database retrieval system