KEGG   Rufibacter tibetensis: DC20_06870Help
Entry
DC20_06870        CDS       T04099                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
rti  Rufibacter tibetensis
Pathway
rti00380  Tryptophan metabolism
rti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DC20_06870
Enzymes [BR:rti01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DC20_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 SHMT Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALI98737
UniProt: A0A0P0C614
LinkDB All DBs
Position
complement(1767489..1768760)
Genome map
AA seq 423 aa AA seqDB search
MSFQNTLAYAQSQDQADPLRSFRDQYHIPQHNGKDTVYLCGNSLGLQPKSARAALENEMV
KWAELGVEGHFTGDNPWFTYHAALAPATARLVGAKPEEVVVMNQLTVNLHLMLVSFYRPQ
GKRYKILTEAGAFPSDQYALESQVKFHGFQPDDAIIEVAPRAGEHTLRTEDIVNTIQQHG
EELALVMMGGVNYYTGQVFDMAAITQAAHGVGALCGFDLAHAAGNVTMQLHDWDVDFAVW
CTYKYLNSGPGGTSGVFIHERHAHNPEIPRFAGWWGHDQNVRFQMKKGFTPMPGADGWQL
SNGQILPMAVHKASLELFDEAGIENLWAKSERLTGYLEFLIKELNQPKEALEVITPAEPS
ARGCQLSLLVHQNGRQLFETLMANGFILDWREPNVIRVAPTPMYNTFEDVHRFGQFLAAH
FNK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcaaaatacccttgcctacgcccaatcacaggaccaggcagacccgcttcgt
tccttccgagaccaataccatattccgcagcataacggaaaagacactgtttacctctgc
ggaaactccttgggcttgcaaccaaaatcggccagagccgccctggaaaacgaaatggta
aagtgggcagaattaggggtggaaggacattttacgggtgacaacccttggtttacgtac
catgccgctttagcgccagctaccgcccgattagtgggagccaagcctgaagaggtggtg
gtcatgaaccaattgaccgtgaacttgcatctcatgctggtgtctttttatcggccgcag
ggaaagcgctacaagattttaaccgaagccggcgctttcccatcagaccagtacgcgctg
gaaagccaggtgaaattccacggctttcagcccgatgatgccatcatagaagttgctcca
cgagcgggcgaacacacgctgcgcaccgaggacattgtcaacaccattcagcagcacggc
gaggaattggccttggtgatgatgggcggggtcaattattacaccggtcaggtgtttgac
atggccgctattacgcaggcagcccatggggtaggtgcgttgtgtggttttgacctggcc
catgcggccggaaacgtaaccatgcaactacacgactgggatgtggactttgccgtgtgg
tgtacttataaatacctgaactctggtccgggcggaacctctggggtgttcattcatgag
cggcacgcccataatccggagatcccaaggtttgccggttggtggggccatgatcaaaat
gtgcgcttccagatgaagaaaggctttactcccatgcctggagccgatggatggcagctt
tccaacggccagattctgcctatggccgtgcacaaagcctctctggagctctttgacgag
gccggcatagagaacctgtgggccaaaagcgaaagactcacgggttatcttgaattcctg
atcaaagaactaaaccagcccaaagaggcgctggaggtgattactcccgcagaaccctcg
gctaggggttgtcagctttcattgctggtgcatcagaacggtaggcagttatttgaaacg
cttatggccaacggcttcatcctggattggcgcgagcccaacgtcatccgcgtggcgcca
acacccatgtacaacacgtttgaagacgtgcaccggtttggccaatttctagcagcccac
ttcaacaagtag

DBGET integrated database retrieval system