KEGG   Rufibacter tibetensis: DC20_10550Help
Entry
DC20_10550        CDS       T04099                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rti  Rufibacter tibetensis
Pathway
rti00620  Pyruvate metabolism
rti01100  Metabolic pathways
rti01120  Microbial metabolism in diverse environments
rti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DC20_10550
Enzymes [BR:rti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     DC20_10550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ALJ01375
UniProt: A0A0P0CHC2
LinkDB All DBs
Position
complement(2615463..2617733)
Genome map
AA seq 756 aa AA seqDB search
MKINKEDALNYHSQGQPGKIEVVPTKMVSTQMDLALAYSPGVAEPCKEIAANKDDVYKYT
AKGNLVGVITNGTAVLGLGNIGPEASKPVMEGKGVLFKKFAGIDVFDIEIDETDPDKFIQ
IVKSLEPTFGGINLEDIKAPESFKIENALREQMNIPLMHDDQHGTAIISSAALLNALEVV
GKDIDKIKMVVNGAGAAAIACTKLYLELGVKIDNIVMFDKDGIINPERNDLDIYRAQFVT
TRKITTLAEAMEGADVFVGLSAGNVLAPELVKLMAKDPIIFALANPDPEIAYETAMATRP
DLIMATGRSDHPNQVNNVLGFPYIFRGALDVRATEINEAMKLAAVYALAELAKEGVPDIV
HKAYGDNSIAFGRTYLIPKPLDPRLITTISPAVAKAAMESGVARFPIQNWDRYHQELQAR
IGIDQKLMNRVLTQARQNPKTVVFAEADHYKILKAAQTVLEQKLAYPVLLGERARIEAMI
AEFNMDLTGSVIIDPREEDAKCEKFAHLLYEKRKRKGLTLFDCRKLVRNRNYFGCMMVET
GEADALISGLTREYSSTILPALHVIGVEEGVNKVAGMYIIQNKKEPYFFADTTVNLQPTA
EELVDIIGLTARYVRFFDREPRMAVLSYSNFGSSSGQVPTKTREATRMAKQRYPDLIIDG
EMQANTALNPELLREHYPFSELANVGANTLIFPGLAAGNIAYKLLQEIGGAEAIGPILMG
MRKPVHILQLGSSVREIINMVAIAVVDAQTCKAKLK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
attaaaatcaacaaggaagacgcgctgaattatcacagccaggggcaacccggcaagata
gaggtagtgcctaccaaaatggtgagcacgcagatggacttagccctcgcctactcgcca
ggtgtagcagagccttgtaaagaaattgccgccaacaaagacgatgtctacaagtacacc
gccaaaggcaacctggtgggtgtgattaccaacggaactgctgtattaggcttgggcaac
attggtcctgaggcttctaagccggtcatggaagggaaaggcgtcctttttaagaagttt
gcgggcattgacgtgtttgacattgagatagacgaaactgacccggacaaattcatccag
attgtaaagtcgctggagcctacgtttgggggtatcaacctggaggatatcaaagcccct
gagagcttcaagattgagaatgccctgcgcgagcagatgaacattccgctcatgcatgat
gaccagcacggcaccgccatcatctctagcgctgccttgttgaacgccctggaagtggtg
ggcaaagacattgataagatcaaaatggtagtgaacggtgccggagccgctgccattgcc
tgcaccaagctctacctggaactgggcgtgaagattgacaacattgtcatgtttgacaaa
gatggcatcatcaacccagagcgcaacgacctggacatataccgggcccagtttgtcacc
acccgtaaaatcaccaccctggctgaggctatggaaggagctgatgtgtttgtgggcctg
agcgccggcaacgttttagcgcctgaattggtgaaactgatggcaaaagaccccattatc
ttcgcgctggcaaacccagatccggagattgcctacgaaaccgccatggctacccgacca
gacctgatcatggccaccgggcgctcagatcatcctaaccaggtgaacaacgtattgggt
ttcccttacattttcaggggagctttggacgtgcgcgccaccgagatcaacgaggccatg
aaactggccgccgtgtatgccctggcagaactggccaaagaaggtgttccggacattgtg
cacaaagcctacggcgataactccatcgccttcggacggacgtatctaatccctaaaccg
ctggacccgcgtttgatcacgaccatcagcccggcggtggcaaaggcagccatggaatct
ggtgtggcgcgtttccctatccaaaactgggatcgctatcaccaggagttgcaggcgcgc
attggtattgaccagaaactgatgaaccgcgtactcacgcaggctcgtcagaaccctaaa
acggtggtatttgctgaggccgatcactacaagatcctgaaagcggctcaaaccgtcttg
gagcagaaattggcctaccctgttttattgggtgagcgggcacgtattgaggccatgatc
gccgagttcaacatggatttgaccggcagcgtgatcattgacccgcgcgaggaagacgcc
aaatgcgagaagtttgcgcacctgctgtatgagaaacgcaagcgtaaaggcctcaccctg
tttgactgccgcaaactggtgcgcaatcggaactacttcggttgtatgatggtggaaaca
ggtgaagccgatgccctcatttctggtcttacccgtgagtactcctctaccattctaccc
gccctacacgtgattggcgtggaagaaggcgtaaataaagtggcaggtatgtacatcatc
caaaacaagaaagaaccttacttcttcgctgatactacggtaaaccttcagcctacggca
gaggaactggtagacattattggtttgacggcccgttatgtgcgcttctttgaccgtgag
ccacgcatggcggtgctttcgtattctaacttcggctccagctccgggcaggtacctacc
aaaacccgcgaggctacccgcatggccaagcagcgttacccagatttgattattgacggg
gaaatgcaagcaaacacggcgttaaacccagagttgttgcgcgagcactatccgttcagt
gagctggccaacgtaggggccaatacccttatcttcccgggtctggcggctggtaacatt
gcttataaacttttacaggaaattggcggggctgaagcaatcggtccaatcctgatgggc
atgcgtaaaccagtgcatatcttgcagttaggttcttcggtgcgggaaatcatcaacatg
gtggccatagccgtggtagatgcccaaacgtgtaaggcaaaactaaaatag

DBGET integrated database retrieval system