KEGG   Rufibacter tibetensis: DC20_15225Help
Entry
DC20_15225        CDS       T04099                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rti  Rufibacter tibetensis
Pathway
rti00620  Pyruvate metabolism
rti00680  Methane metabolism
rti01100  Metabolic pathways
rti01120  Microbial metabolism in diverse environments
rti01200  Carbon metabolism
Module
rti_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DC20_15225
  Energy metabolism
   00680 Methane metabolism
    DC20_15225
Enzymes [BR:rti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DC20_15225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Fucose_iso_N1
Motif
Other DBs
NCBI-ProteinID: ALJ00077
UniProt: A0A0P0CTW9
LinkDB All DBs
Position
complement(3733090..3735666)
Genome map
AA seq 858 aa AA seqDB search
MDGSSTSALQNYDKHVGLKFQLYNSLFTSLPFHRVEKTGVLLSIFLLHCEEGFAKEQSPD
EIISTFFNQYTPYRTEQEQLDLLFRFVQYAERQVVLFDALEDASFRETHDMAGAGTLKHL
QAEVEQTQTQAQLQEKLKDFSVRLVLTAHPTQFYPSEVLGIINDLSKALLNDNTAQVNSY
LRQLGKTPFFKNEKPSPYDEAVSLIWYLENVFYQAAGQIMSHLKSQFPEAVSEENPLIRL
GFWPGGDRDGNPFVTASITLRVAEALRGAIIKSYYQDVRRLKRRLTFKGILNELISLEEK
LYNNLFLPGYKADITKEAILAPLLRIKDILIREHNSLFLPLAENLIRKVELFGLFFASLD
VRQDSSAHTEALEAIAATSGALPENYSQLSAKEKISALLNANTTVAAESLENELHRDTLE
SMQAMKTIQEINGSEGCHRYIISHSTSALDVMEVYGLFMLSGWKPEELSVDIVPLFETID
DLKNAHDVMEALYNSEVYRQHLHRRGNIQSIMLGFSDGTKDGGYLMSNWSIYKAKEELSR
LAQQYDLQVVFFDGRGGPPARGGGRTHQFYASMGPTIASKEIQLTIQGQTISSNFGTIDA
AQYNMEQLMHAGIRNTLFSSKETTFTDQEEDLMQRLAEESYVAYNTLKNNPYFLEYLNYA
SPLRYYAEANIGSRPSKRKPGKLNLNDLRAVPYVGSWSQLKQNLPGYYGVGAAMERMEAE
GQWEAIEHLYSRSLFFRTLLGNCEMAMTKCFFPLTAFLSKHPHYGELWNNIHEEFERTKK
YVLRLTKNAHLMEDKPVNLLSIQMRQRIEMPLLTIQQFALTKIREMEEQENNTPGKSKFE
KLVMRCSFGIINAERNSA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggatggttcttctaccagtgccctgcaaaactacgacaaacacgtagggcttaaattt
cagctatataacagtcttttcacctccttgcccttccacagagtagagaaaaccggggta
ttactgtctattttcctgctgcactgtgaagaaggctttgcaaaagagcagagccccgat
gagattatcagcacgttcttcaatcagtataccccctaccgaaccgagcaggagcagctt
gatctgcttttcaggtttgtgcagtacgctgagcggcaggtagtgctttttgatgcgctg
gaagatgcctctttccgggagacgcatgatatggccggggcaggtaccctcaagcacctg
caggccgaagtggagcaaactcaaacacaggcacagttacaggagaaacttaaggatttt
tcagtacgcctggtgcttaccgcccaccctacccagttttaccccagtgaggtattaggt
atcatcaatgatttatcaaaagcgttgctgaacgacaacacggcgcaggtaaacagctac
cttcggcagttaggcaaaaccccgttcttcaaaaacgagaagccctctccgtatgacgag
gccgtgagtttgatctggtacctggaaaacgtcttctaccaggccgccggacaaatcatg
tctcaccttaaaagccagttcccggaggccgtttcagaagaaaaccctttgatcaggtta
ggcttctggcctggaggcgatcgggatggtaatccgttcgtaactgcttccattaccctg
cgggtagcggaggctctgaggggagccatcattaaatcgtattaccaggatgtacgccgg
ttaaagcgtcgtcttacgttcaaggggatcttgaatgaactgatctcgttggaggagaag
ctgtacaataacctcttcttgcccggttacaaagcagatatcaccaaagaagccattctg
gctccgctgcttagaatcaaagatattttgatccgtgagcataattcccttttccttccc
ctggccgaaaacctgatcagaaaggtagagctgttcggactatttttcgcgtctctggat
gtgcgccaggacagttccgcgcataccgaagccttggaagccattgctgctaccagcggt
gccttaccagaaaactactcccaactttctgccaaggaaaaaatatcagccttgctgaac
gccaacaccaccgtagcggcagagtcactggagaatgaactgcaccgtgataccctggag
tctatgcaggccatgaaaaccattcaggaaattaacggttccgagggttgtcaccgttac
atcatcagtcatagcaccagtgccctggatgtgatggaggtgtatggcttattcatgctc
agcggctggaaacccgaagaactttccgtggacattgtgcctctttttgagactattgac
gacttgaaaaacgcacatgacgtgatggaggcgttgtacaactcagaggtgtaccgccaa
catctgcaccgccgcggaaatatccagagcattatgctgggcttctcagatggtaccaaa
gacgggggttatctcatgtctaactggagcatatacaaagccaaggaagaactgagcagg
ttggcccagcagtacgatttgcaggtggtgttctttgacggccggggcggacctcctgcc
cgagggggcggaagaacgcaccagttctatgcttccatgggccctaccattgccagcaag
gaaatccagttgaccattcaggggcagaccatcagttccaacttcgggaccattgatgcg
gcgcagtacaacatggaacagctcatgcatgccggtatcagaaacactttgttctcttct
aaagagaccacctttacggaccaggaagaagacctcatgcagcggttggccgaggaaagt
tatgtggcgtacaacacccttaagaacaacccttatttcctggagtacctgaattacgcc
agccctttgcggtattacgccgaggctaacattggaagccgcccgtctaaacggaagccg
ggcaaactgaacctgaacgatttgcgagcggtgccttacgttggttcctggagccagtta
aagcagaacctgccgggttactacggagtgggcgccgctatggaaagaatggaagccgaa
ggccaatgggaggccattgaacacctttactcccgctcccttttcttccgtacattacta
ggcaactgcgagatggccatgacgaagtgctttttcccgcttacggcctttttgtcaaaa
caccctcattacggcgagctctggaacaacatccatgaggagtttgagcgcaccaaaaag
tatgtgctccgcctcaccaaaaacgcgcacctcatggaagacaaaccagtgaatctgctt
tccatccagatgcgccaacgcatagaaatgcctttgcttaccatccaacaatttgccctc
accaaaatcagggagatggaggaacaggaaaacaacaccccaggcaaaagtaagtttgag
aaactggtcatgcgttgctccttcgggatcatcaacgcagaacggaactcggcttag

DBGET integrated database retrieval system