KEGG   Rufibacter tibetensis: DC20_16455Help
Entry
DC20_16455        CDS       T04099                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rti  Rufibacter tibetensis
Pathway
rti00010  Glycolysis / Gluconeogenesis
rti00020  Citrate cycle (TCA cycle)
rti00620  Pyruvate metabolism
rti01100  Metabolic pathways
rti01110  Biosynthesis of secondary metabolites
rti01120  Microbial metabolism in diverse environments
rti01130  Biosynthesis of antibiotics
rti01200  Carbon metabolism
Module
rti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DC20_16455
   00020 Citrate cycle (TCA cycle)
    DC20_16455
   00620 Pyruvate metabolism
    DC20_16455
Enzymes [BR:rti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DC20_16455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C DUF2118 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ALJ01517
UniProt: A0A0P0CXI7
LinkDB All DBs
Position
complement(4043012..4044730)
Genome map
AA seq 572 aa AA seqDB search
MAEIIRMPKMSDTMTDGVIASWLKKVGDSVKSGDVLAEVETDKATMELESYEDGTLLYIG
PKNGESVPVDGVLAIIGKQGEDISGLMAQVNGGGAAPAAQEAPKAEAPKEEPKQAASPAA
QSAPAANVNAEVVRMPKMSDTMQEGTIVAWHKKVGDKVKSGDLLAEVETDKATMELESYE
DGTLLYIGVEAGASVEVDGVLAIIGEAGADYQALLNGGGNNSGGNANPAEAANNEEATRL
EEHKTEEQSQSGDGVNQTVGAPVPGQGAEAGANGASANQGRILASPLAKKVAQEKGISLT
QVKGSGENGRIVLRDVENFTPSAAPQTQAKPAAAPAPQVSAPVHSGEAFTEVPVSQMRKV
IARRLSESLFTAPHFFLTMEIDMDKAMEARTSMNEVAPVKVSFNDMVIKACAAALRKHPA
VNSSWLGDKIRYNNVVNIGVAVAVEDGLLVPVVRNADQKSLSTISAEVKDLGGKAKSKKL
QPSDWEGSTFTISNLGMFGIEEFTAIINPPDACILAVGGIKQTPVVKNGQIQIGNVMKVT
LSCDHRVVDGAVGSAFLQTLKGFLEDPVRMLV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcatccgaatgcccaagatgagtgatactatgaccgatggggtcattgcc
tcatggttaaagaaagttggtgactctgtgaaatctggggacgttcttgccgaagtggaa
accgataaggcgaccatggaattggagtcttatgaagatgggacgttactgtacatcggc
cctaaaaatggtgaatctgtacccgtagatggcgtgttggccatcatcgggaaacaaggt
gaagatatctctggcctcatggcccaagtgaacggcggaggcgctgcccctgccgcccag
gaagctcctaaggctgaagcgccgaaggaagaacctaaacaagccgcttctcctgctgcc
cagtcagcccctgccgccaatgtgaatgccgaagtggttcgcatgccaaaaatgagcgac
accatgcaggaaggtaccattgtagcctggcacaaaaaagtaggtgacaaagtaaaatct
ggtgacctgttggccgaagtagaaacggacaaagccaccatggagctggagtcttatgaa
gacggtacactcttatatataggcgtagaagctggtgcctctgtagaggtagacggcgtg
ttggccattatcggtgaagcaggtgccgactaccaggctttgctgaacggcggtggtaac
aattctggcggtaacgctaaccctgctgaagcggcaaacaacgaagaagcaactcgcctc
gaagaacataaaaccgaagagcagtctcaatccggtgacggggtaaaccaaaccgttggt
gctcctgtaccaggtcagggtgctgaagcaggcgccaacggtgcatcagcgaaccagggt
cgcatattggcttctccgttagcgaagaaagttgcccaggaaaaaggcattagccttacc
caggtgaaaggctccggtgagaacggccgcattgtattgcgtgacgtggagaactttact
cctagcgctgctccgcaaactcaagctaaacctgccgctgctccagctccgcaggtttct
gctccggttcattctggtgaagccttcacagaggttccggtatctcagatgcgtaaggta
attgcccgtcgtctttctgaaagcttattcactgcaccgcacttcttcctaaccatggag
attgacatggacaaagccatggaagctcgtaccagcatgaatgaggtagctcccgtgaaa
gtttctttcaatgacatggtgatcaaggcatgtgccgccgctttacgcaagcacccagct
gtaaactcatcttggttgggcgacaagatccgctacaacaacgtggtgaacattggagta
gccgtagctgtggaagatggtttattggtaccagtagtgcgtaacgctgatcagaagtca
ctttcaaccatctctgccgaagtaaaagatttaggcggaaaagccaagtccaagaaacta
cagccgtctgactgggaaggaagcaccttcaccatctctaacctgggtatgtttggcatt
gaggaatttaccgctatcatcaacccaccagatgcatgtatcctagccgtgggtggtatc
aagcagacaccagtggtgaagaatggtcagatccagattggcaacgtcatgaaagtaacg
ctttcctgtgatcaccgtgtggttgacggagctgttggttctgccttcttgcagacgctg
aaaggcttcctggaagatccggtgagaatgttggtataa

DBGET integrated database retrieval system