KEGG   Rufibacter tibetensis: DC20_22050Help
Entry
DC20_22050        CDS       T04099                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rti  Rufibacter tibetensis
Pathway
rti00630  Glyoxylate and dicarboxylate metabolism
rti01100  Metabolic pathways
rti01120  Microbial metabolism in diverse environments
rti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DC20_22050
Enzymes [BR:rti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DC20_22050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALJ01727
UniProt: A0A0P0C8W6
LinkDB All DBs
Position
p1:complement(190513..191760)
Genome map
AA seq 415 aa AA seqDB search
MERITAKYLIETPLEVEAAAQVLAGEQSSGTFVEVPGETAELKRRFAARVESITPLETVT
EPAIPGAVSDKRLYHRAMLEVSWSIENFGYNLPVLISTLQGNLYELTQFTGLKLMDLEVP
SSFATHFSGPKFGIKGCRQLTGVEERPLIGTIIKPSIGMTPQQTADLVKTLAEAGIDFVK
DDELMSASANSSFEDRLDMVTRVINDHADKTGKKVMYAFNITDEIDVMLRRYEKIVASGG
TCAMVSLNSVGLAGVKKVCDQGQLAIHGHRNGWGMLNRHPFLGIEFPAYQKLWRLAGVDQ
IHVNGIQNKFWESDDSVVRSIEACLKPMLGGYSVLPVVSSGQWGGQAPETYRRTQTTDLL
YMAGGGIMAHPSGPCGGVVAMRQAWEAAVQGLTVEEAARQYPEFRESVEKFGTRK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggatcaccgcaaagtacctcatagaaacgccgctggaagtagaggctgctgcc
caggtgctggcaggggagcaatcgtcgggtacgtttgtggaggtgcccggcgagacggct
gaactaaaacggcgctttgcagcccgggtagagtcaataacaccgctggaaaccgtgacg
gagcccgctataccaggggctgtgtcagataaaagactataccacagagcaatgttggaa
gtgtcttggtcaatcgaaaacttcggctataaccttcctgtcttgatttcaacgctacag
ggtaatctgtatgaactcactcagtttacaggtttgaaactgatggacctggaggtgcca
tcctcctttgcaacacattttagtgggccgaaatttggcataaaggggtgccgccagttg
actggggtagaagaacgaccgctaataggcaccatcatcaagcccagtattggcatgacg
ccgcagcagaccgccgaccttgtgaaaacactggctgaggcaggtattgatttcgtgaaa
gacgatgaactgatgtcggcttcggccaattcctcttttgaggaccgtctggacatggta
acgcgcgtcatcaacgaccatgccgataaaacaggcaaaaaggtgatgtatgcttttaat
ataactgacgaaatagacgtaatgctgcgccggtacgagaagatagttgcctctggtggc
acttgtgccatggtcagcctgaacagtgtgggattggccggtgtcaaaaaggtgtgtgac
caggggcaactggctatacacgggcatagaaacggctggggtatgctgaaccggcatccg
tttctgggcatagagtttcctgcttaccaaaagctttggcgtttggctggggtagaccag
attcacgtgaatggtatccaaaacaaattctgggaatcagacgattcggtggtccgttca
attgaggcttgtctaaaacccatgctgggcgggtactctgtcctgcctgttgtatcatcg
gggcagtggggcgggcaggcacctgagacttaccgccgtactcagactaccgatctgctg
tatatggcaggtggtggcattatggcacatcctagcgggccatgtggtggtgtggtagcc
atgcgccaggcatgggaggcagcagtgcaagggctaacagtggaagaggctgcgcggcag
taccccgaattccgggaatcagttgaaaagtttggaaccaggaaatga

DBGET integrated database retrieval system