KEGG   Rhodococcus triatomae: G4H71_04120
Entry
G4H71_04120       CDS       T06846                                 

Definition
(GenBank) transaldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
rtm  Rhodococcus triatomae
Pathway
rtm00997  Biosynthesis of various secondary metabolites - part 3
rtm01100  Metabolic pathways
rtm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rtm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    G4H71_04120
Enzymes [BR:rtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     G4H71_04120
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: QNG22322
LinkDB
Position
878207..879088
AA seq 293 aa
MLTLPARAHRHTPSGKRIRLSRISDHRTGRTLVVPLDHSVTVGPLGSADHADTLIRTLAD
AGADAVVLHRGRARHVDPDAFANMGLIVHLSAGTTMSIDTHAKTLVAGVEDALRMGADAV
SVHVNIGSATERVQLEDFGRISAECETLGVPLLAMMYARGAGRSGMPTAAELAHLASIAT
DLGADMVKLDYSGSSETMRAVAASCPLPICVAGGDRAGDDQDVVALAAEIMDSGVAGLSF
GRNIFEATHPHGVASALAHLVHDRGSAGNRTGTGTHNAVIGERIDVAAQLETA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgctgacgttgcctgcacgcgcgcaccggcataccccgagcggcaagcgaatccggctg
tcccggatctcggaccaccggaccggtcgcaccctcgtcgtcccgctggaccactcggtc
accgtcggcccgctgggcagcgccgaccacgccgacaccttgatccggaccctggccgac
gccggtgccgacgccgtcgtcctgcatcgcggccgcgccaggcacgtcgatcccgacgcc
ttcgcgaacatggggctgatcgtgcacctgtccgcgggaaccaccatgagcatcgacacc
cacgccaagaccctggtcgccggggtggaagacgcgctccggatgggcgcggacgcggtg
agtgtccacgtcaacatcggttcggccaccgaacgggttcagctcgaggacttcggacgg
atctcggcggagtgcgagacgctcggcgtccccctgcttgcgatgatgtatgcccgcgga
gcgggacgcagcggtatgcccaccgcggccgagctcgcccacctcgcgtcgatcgcgacc
gatctgggtgccgacatggtcaaactcgactacagcggatccagcgagacgatgcgggcg
gtggcggcgagctgcccgctgccgatctgcgtcgcgggcggtgaccgtgcgggcgacgac
caggacgtcgtcgcgctcgccgccgagatcatggattcgggagttgcgggcctgagcttc
ggacgcaacatcttcgaggccacccacccgcacggagtcgcctccgcgctggcacacctg
gtccacgaccgcgggtctgccgggaatcgcaccggcacaggcactcacaatgcggtgatc
ggcgagcgaatcgacgtcgccgcccagctcgagaccgcctga

DBGET integrated database retrieval system