KEGG   Rathayibacter tritici: A6122_0417Help
Entry
A6122_0417        CDS       T04388                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00010  Glycolysis / Gluconeogenesis
rtn00030  Pentose phosphate pathway
rtn00051  Fructose and mannose metabolism
rtn00052  Galactose metabolism
rtn00680  Methane metabolism
rtn01100  Metabolic pathways
rtn01110  Biosynthesis of secondary metabolites
rtn01120  Microbial metabolism in diverse environments
rtn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6122_0417
   00030 Pentose phosphate pathway
    A6122_0417
   00051 Fructose and mannose metabolism
    A6122_0417
   00052 Galactose metabolism
    A6122_0417
  Energy metabolism
   00680 Methane metabolism
    A6122_0417
Enzymes [BR:rtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A6122_0417
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     A6122_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AND15577
UniProt: A0A160KQP6
LinkDB All DBs
Position
complement(460412..461440)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVYKGIKVYDQEFVGFRNGWHGVVDGDFLPLGRPEIQGI
AKQGGTIIGTSRTNPFEGENGGPENIAEMMARNGIDSIIAIGGEGTLAAAKRLTDAGLKI
VGVPKTIDNDLGATDYTFGFDTAVGIATDAMDRLRTTGDSHGRCMVAEVMGRHVGWIALH
SGMAAGAHVILIPEKRTSLDQIVEWVQSAQDRGRAPLVVVAEGFSLDTMDDAHSERGLDA
FGRPRLGGIGELLAPLIEERTGIETRATTLGHIQRGGTPTAFDRVLATRLGMAAIDSVVA
EHWGRMVALRGTDIYHVDFAEALGILKTVPDARYEEARILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgggatcctgacctccggcggcgactgccccggcctcaatgccgtcatccgc
ggtgccgtgtacaagggcatcaaggtctacgaccaggagttcgtcgggttccgcaacggc
tggcacggcgtggtcgacggcgacttcctgccgctgggtcgacccgagatccagggcatc
gccaagcagggcggcacgatcatcggcaccagccgcacgaaccccttcgagggcgagaac
ggcggaccggagaacatcgcggagatgatggcccgcaacggcatcgattcgatcatcgcc
atcggcggcgagggcactctcgccgcagccaagcgcctcaccgatgcgggcttgaagatc
gtcggcgtccccaagaccatcgacaacgacctcggcgccaccgactacaccttcggcttc
gacaccgccgtcggcattgcgaccgatgcgatggaccgcctccgcaccaccggcgactcg
cacggccgctgcatggtcgccgaggtcatgggccgccacgtcggctggatcgcgctgcac
tccggtatggccgcgggtgcccacgtcatcctgatcccggagaagcgcacgtcactcgac
cagatcgtcgagtgggtgcagagcgctcaggatcgcggccgcgcgccgctggtcgtggtc
gccgagggcttctcgctcgacacgatggacgacgcccactcggagcgaggcctcgacgcc
ttcggccggccccgcctcggcggcatcggcgagctgctcgccccgctcatcgaggagcgc
accggcatcgagacccgcgccaccacgctcggccacatccagcgcggcgggacgcccacc
gcattcgaccgcgtgctcgcgacccgcctgggcatggccgcgatcgactccgtcgtggcc
gagcactggggccgcatggtcgccctgcgcggcaccgacatctaccacgtcgacttcgcc
gaggccctcggcatcctcaagacggtgcccgacgcccgctacgaggaggcgcgcatcctc
ttcggatag

DBGET integrated database retrieval system