KEGG   Rathayibacter tritici: A6122_0691Help
Entry
A6122_0691        CDS       T04388                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00020  Citrate cycle (TCA cycle)
rtn00480  Glutathione metabolism
rtn01100  Metabolic pathways
rtn01110  Biosynthesis of secondary metabolites
rtn01120  Microbial metabolism in diverse environments
rtn01130  Biosynthesis of antibiotics
rtn01200  Carbon metabolism
rtn01210  2-Oxocarboxylic acid metabolism
rtn01230  Biosynthesis of amino acids
Module
rtn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6122_0691
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6122_0691
Enzymes [BR:rtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A6122_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AND15844
UniProt: A0A160KRC8
LinkDB All DBs
Position
752004..753221
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQKIKDTLIHPYLDVNLEYYDLGIEHRDETDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATDFVFKGKGTLTVEFTPEDGSEPMKFEVYKAPDDGIAQV
QYNQDASIRDFARSSLNYGLSRNYPVYLSTKNTILKAYDGRFKDIFEEIFETEFKERFDA
AGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGS
VVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTRGLAHRGTLDGNQELIDFSLTLED
VVITTVESGKMTKDLALLVGPEQGWQTTEEFLATLDENLKVRMSA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgagggaacagtcgtcgagctcgacggcgacgagatgacacgc
atcatctggcagaagatcaaggacaccctcatccacccgtacctcgatgtgaacctcgag
tactacgacctcggcatcgagcaccgcgacgagacggacgaccaggtcacgatcgacgcg
gcgcacgccatccagaagcacggggtcggcgtgaagtgcgcgaccatcacgcccgatgag
gcccgcgtcgaggagttcggcctgaagaagatgtggaagtcgcccaacggcacgatccgc
aacattctcggcggcgtgatcttccgcgagccgatcatcatctcgaacattccgcgcctg
gttccgggctggaacaagccgatcatcatcgggcgccacgcattcggcgaccagtaccgc
gccaccgacttcgtcttcaagggcaagggcacgctcaccgtcgagttcacgcccgaggac
ggctccgagccgatgaagttcgaggtctacaaggcccccgacgacggcatcgcgcaggtc
cagtacaaccaggacgcctcgatccgcgacttcgctcgctcgtccctgaactacggcctc
tcgcgcaactacccggtctacctctcgaccaagaacacgatcctcaaggcctacgacggg
cgcttcaaggacatcttcgaggagatcttcgagaccgagttcaaggagcgcttcgacgcc
gccggtctcacgtacgagcaccgcctcatcgacgacatggtcgcctcggccatgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacaccgtc
gcccagggcttcggatcgctcggcctgatgacctcggtgctctccactcccgacggaagc
gtcgtcgaggcggaggcggcgcacggcacggtcacgcgccactatcgccagcaccaggcg
ggaaagcccacctcgaccaacccgatcgcctcgatctacgcctggacgcgcggcctcgcg
caccgcggcacgctggacggcaaccaggagctcatcgacttctcgctcacgctcgaggac
gtggtcatcacgacggtcgagtccggaaagatgacgaaggacctcgccctgctcgtcggc
cccgagcagggctggcagacgaccgaggagttcctcgcgaccctcgacgagaacctgaag
gtgcgcatgtcggcctga

DBGET integrated database retrieval system