KEGG   Rathayibacter tritici: A6122_1093Help
Entry
A6122_1093        CDS       T04388                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00620  Pyruvate metabolism
rtn00680  Methane metabolism
rtn01100  Metabolic pathways
rtn01120  Microbial metabolism in diverse environments
rtn01200  Carbon metabolism
Module
rtn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6122_1093
  09102 Energy metabolism
   00680 Methane metabolism
    A6122_1093
Enzymes [BR:rtn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A6122_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AND16241
UniProt: A0A161JNZ2
LinkDB All DBs
Position
complement(1246855..1249533)
Genome map
AA seq 892 aa AA seqDB search
MPSFSDASAAPASSAAPSSADGTTAPVLEERIRADVHLLGELLGQVLRESGEPALYEDVE
RLRALTISAYDSGDAAGTAEAEEFVASLSLERAEEVARAFTCYFHLVNVAEEFHRVRVLR
RREADAGAQSPEDSILASMRRLTGELGEAEAFARLSRLEFRPVLTAHPTEARRRAVASTI
RRISDLLEQRDDPRMGGVVLVEIRRRLLAEVDTLWRTAPLRESKPTPLDEVRTAMSVFDE
SLFSVLPRVYRRLDDALLGEGSGTRAPVAPAFVRLGTWIGGDRDGNPFVTAETTLAAVDI
ASEHVLMGLERVARRVGRALTLDASTTPPSAAVEALWASCVERAPELATDIAERSPNETH
RRVLLFAAERLAATRSEGPLAYSAATELLGELRTLQESLVEADDVRAAYGDLQDFVWQLE
TFGFHLAEIEVRQHSKVHRETIAALRAGEELDDRGREVLAVFRAIARVQERFGTGAARRY
IVSFTQSADDLRTVFELAEAATDGEPPIIDAVPLFETFADLDASTDILAEMIRLPQVQAR
LAATGNRLEVMLGYSDSSKDVGPVSATLALYDAQARIAQWAADEGIVLTLFHGRGGALGR
GGGPANRAVLAQPPGSVDGRFKLTEQGEVIFARYGNPDIATRHIEQVAGATLLASSPAVG
ERNAAAAERFAEVAATMDRESRRRFFELVKADGFAPWFARVTPQEEVGLLALGSRPARRG
LSVESLEDLRAIPWVFAWTQARVNLTGWFGLGSALEAVGDLDLLREAYASWPLFTTMVDN
VEMSLAKTDEGIARRYLALDSRDDLAGLVLEEMALTRRWVLSITGEESLLTGHRVLGRAV
RLRTPYVNALSLLQLRALRALRTDPGGPGTEQNQRLLLLAVNGVAAGLQNTG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcgttctccgacgcgtccgccgcacccgcctcctccgccgccccgtcctccgcc
gacgggacgaccgcgcccgtgctcgaggagaggatccgcgccgacgtccatcttctgggc
gaactgctcggccaggtcctgcgcgaatcgggtgagcccgcgctctacgaggacgtggag
cgcctcagggctctgacgatcagcgcctacgacagcggcgacgcggcggggacggccgag
gcggaggagttcgtggcctcgctctcgctcgagcgcgccgaggaggtggcccgagccttc
acctgctacttccatctcgtcaacgtggcggaggagttccaccgggtgcgggtgctgcgc
cgccgcgaggcggatgcaggcgcgcagtcgccggaggattcgatcctcgcctcgatgcgc
cgcctcaccggcgagctcggcgaggccgaggcgttcgcacgcctctcccgcctggagttc
cgccccgttctgacggcgcacccgaccgaggcccgccgtcgtgcggttgcctcgaccatc
cggcgcatcagcgacctgctcgagcagcgcgacgatccgcgcatgggcggagtcgtgctg
gtcgagatccgtcgtcggctgctggccgaggtcgacactctctggcgcacggcgccgctg
cgcgagtcgaagccgactccgctggacgaggtgcgcacggcgatgagcgtgttcgacgag
tcgctgttctcggtgctcccccgggtctaccgccgcctcgacgacgccctgctcggtgag
ggctcgggcacgcgcgcgccggtcgcgccggccttcgtccgcctgggcacctggatcggc
ggtgatcgcgacggtaacccgttcgtcacggccgagacgaccctcgcggcggtcgacatc
gcctcggagcacgtcctgatgggcctcgagcgcgtcgcccgtcgcgtgggccgcgcgctg
acgctcgatgcgtcgaccactccgccctccgccgccgtcgaggcgctctgggcgtcctgc
gtcgagcgcgcccccgagctcgccaccgacatcgccgagcgctcccccaacgagacgcac
cggcgggtcctgctcttcgcggccgagcgcctggccgcgacacgctccgaggggccgctg
gcctactccgccgccaccgagctgctcggcgagctgcgcacgctgcaggagtccctggtc
gaggccgacgacgtccgcgcggcctacggcgacctgcaggacttcgtctggcagctcgag
accttcggcttccacctggccgagatcgaggtgcgccagcactcgaaggtccaccgcgag
acgatcgccgcactccgcgccggcgaggagctggatgatcgtggccgcgaggtcttggcg
gtgttccgcgcgatcgcgagggtccaggagcgcttcggcaccggtgccgcgcggcgctac
atcgtctcgttcacgcagtcggccgacgacctccgcacggtcttcgagctggcggaggcg
gccaccgacggcgagccgccgatcatcgacgcggtcccgctcttcgagaccttcgccgac
ctcgacgcgtccaccgacatcctcgccgagatgatccgcctccctcaggtgcaggcgcgc
ctcgcggcgacgggcaaccgcctcgaggtgatgctgggctactccgactcgtcgaaggac
gtcggaccggtctcggcgacgctcgcgctctacgacgcgcaggcgcgcatcgcgcagtgg
gcggccgacgaggggatcgtgctgacgctgttccacggtcgcggcggcgcgctcggtcgc
ggcggcgggccggccaaccgtgccgtgctcgcgcagccgccgggatcggtggacggccgc
ttcaagctgacggagcagggcgaggtcatcttcgcccgctacggcaacccggacatcgcg
acccggcacatcgagcaggtggcgggcgcgacgctgctcgcctcctcccccgcggtcggc
gagcgcaatgccgcagccgcggagcgcttcgccgaggtcgccgcgacgatggaccgcgag
tcgcgccgccgcttcttcgagctggtgaaggccgacggcttcgcgccgtggttcgcccgg
gtgaccccgcaggaggaggtgggcctgctcgcgctcggctcgcgtcccgcccgtcgcggg
ctctccgtcgaatcgctcgaggacctgcgcgcgatcccctgggtcttcgcgtggacgcag
gcccgggtcaacctgaccggctggttcggtctgggcagtgccctcgaggcggtcggcgac
ctggacctgctgcgcgaggcctacgcctcctggccgctgttcacgacaatggtcgacaac
gtcgagatgtcgctcgcgaagaccgacgagggcatcgcccgccgctacctcgccctcgac
tcccgggacgatctcgccgggctcgtgctcgaggagatggcgctcacccgccggtgggtg
ctctcgatcaccggcgaggagagcctgctcaccggccaccgcgtgctcggccgcgcggtg
cggctgcgcaccccctacgtcaacgcgctctcgctcctgcagctgcgggcgctgcgggcg
ctgcgcaccgaccccggaggaccggggacagagcagaaccagcggttgctgctgctcgcg
gtcaacggcgtcgcggcggggttgcagaacacgggctga

DBGET integrated database retrieval system