KEGG   Rathayibacter tritici: A6122_2473Help
Entry
A6122_2473        CDS       T04388                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00790  Folate biosynthesis
rtn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A6122_2473
Enzymes [BR:rtn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A6122_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Plectin
Motif
Other DBs
NCBI-ProteinID: AND17589
UniProt: A0A160KV91
LinkDB All DBs
Position
complement(2838044..2838904)
Genome map
AA seq 286 aa AA seqDB search
MGTSVAELTPTGRAALLGILNVTPDSFSDGGHWLSVDDAVRHGLDLTRPAGDGPASFGAD
LVDVGGESTRPGAARVDTAAEQGRVLPVVRALAAEGVRVSIDTMSAATAQAALDVGAVVV
NDVSGGLADPRMLPLVAERGAVYIAMHWRGHSAGMTALASYGDVVADVRGELERRIDAAR
AAGIRDDLLLLDPGLGFAKNGAHDWALLAGLDAIVSLGFPVLVGHSRKRFLAPFAPAGAP
AADRDEVSAMLSLVAAEHGAWGVRVHDVRSSARALALAARLQEETL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacctccgtcgccgagctcacgccgaccggccgcgccgcgctcctcgggatcctc
aacgtcacgccggactcgttcagcgacggcggccactggctctcggtcgacgatgccgtg
cgccacgggctcgacctgacccggcccgccggcgacgggcctgcctccttcggagccgac
ctggtcgacgtcggcggtgagagcacccgcccgggcgccgcccgcgtcgacaccgcggcg
gagcagggtcgcgtgctacccgtcgttcgcgcgctcgcggcggagggagtgcgcgtgagc
atcgacacgatgagtgccgccactgcgcaggcggccctggacgtcggagccgtggtcgtc
aacgacgtctccggcggcctcgccgacccgcggatgctgccgctggtcgctgagcgcggc
gccgtctacatcgcgatgcactggcgcggtcacagcgcggggatgaccgcgctcgcctcc
tacggcgacgtggtcgcggacgtgcgcggcgagctcgagcgccggatcgacgccgctcgc
gccgcggggatccgcgatgacctgctcctgctcgacccggggctcggcttcgcgaagaac
ggcgcgcacgactgggctctgctggccgggctcgacgcgatcgtctcgctcgggttcccg
gtgctcgtcgggcactcgcggaagcggttcctcgctccgttcgcccccgccggcgctccg
gccgccgaccgcgacgaggtctcggccatgctgagcctcgtggccgccgagcacggcgcc
tggggcgtgcgggtccacgacgtccgctcgtccgcccgcgccctggcgctcgccgcccga
cttcaggaggagaccctgtga

DBGET integrated database retrieval system