KEGG   Rathayibacter tritici: A6122_2883Help
Entry
A6122_2883        CDS       T04388                                 

Definition
(GenBank) hypothetical protein
Organism
rtn  Rathayibacter tritici
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp23 DUF2189
Motif
Other DBs
NCBI-ProteinID: AND17991
UniProt: A0A161JPJ8
LinkDB All DBs
Position
complement(3301367..3302197)
Genome map
AA seq 276 aa AA seqDB search
MYRGASRPPATTSDHLEKIMTTATPTSLADGSSVTHGTATTTIADGVVEKVADSAARGDS
CAHDRGNAAARALRAAVTAQDRGQGISVEVGEGQVAASLTVVTAPLTAGRALDPRLVRLT
THSSRTGSAIALAVLLILLFVWLGTEAVLAVLGRPALFVAPQDGASSLLTAAAVPIALTA
AAGAVLALVGLVLIVVSLASNRREGSPPRWRRSSARSGPGSRRPSPGSTGRGTRSRAFAG
IWGGTTLPEYRGRGLYGLVRVSTTPRSRRRRTHNEG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcggagcatcgcggccaccggccacgacctccgatcacctggagaagatcatg
accaccgctacccccaccagtctcgccgacggctcctccgtcacgcacggcaccgccacg
acgacgatcgccgacggcgtggtcgagaaggtcgcggacagtgcggctcgaggggactcc
tgcgcgcacgatcggggcaacgccgccgcccgcgccctccgtgccgcggtcaccgcgcag
gaccgcggccagggcatctccgtcgaggtcggcgaggggcaggttgctgcctccctcacc
gtcgtgacggctcccctcactgccggccgggcgctcgacccgcggctggtgcggctcacg
acgcattcgtcccgcaccggatcggcgatcgccctcgccgtcctgctcatcctcctgttc
gtgtggctgggcacggaggcggtcctcgccgtcctcggccgccccgcgctgttcgtggcc
ccccaggacggagcgtcgtcgctgctgaccgcggccgctgttcccatcgcgctgaccgcc
gccgccggtgccgtgctggctctggtcgggctcgtcttaatcgtcgtgtcgctcgcgtcc
aaccgccgcgaggggtcgccgccgcgatggcgacgctcgtccgctcgatctggccccggt
tcgcggcggccttcgccagggtcgaccgggcgcggcacgcgatcccgggctttcgccggt
atctggggcggaacgacgctgccggagtaccgcggacgcgggctctacggcctcgtccgc
gtctcgaccacgccccggtcccgccggcgccggacgcacaacgaaggctga

DBGET integrated database retrieval system