KEGG   Rhincodon typus (whale shark): 109910523
Entry
109910523         CDS       T06055                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109910523 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rtp04052]
    109910523 (epo)
Cytokines and growth factors [BR:rtp04052]
 Cytokines
  CSF and other factors
   109910523 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109910523
NCBI-ProteinID: XP_020365312
LinkDB
Position
Unknown
AA seq 202 aa
MGNRFAHGSSRNVIAEDYEVLDMGISGLFALLVMFLGYIKPAKSTPLHPICDIRVLDKYI
REAKDAADSTKQCAEACTLPGNFTLPKTNVNYREWETKDSGTKAEEVQTGLKLLAVAVQK
AQNMTVNSNMLYLIERSYSNIRSITQMVRSLRTPDILNRERELQTTFNTRTLRTIFHAYL
NFLQGKVRLFFLDTEACNLATS
NT seq 609 nt   +upstreamnt  +downstreamnt
atgggaaacagattcgcgcatggcagctcaagaaatgtaatcgcagaggactatgaagtt
ttggatatggggatatcaggactttttgcactcctggtgatgtttctcggttatataaag
ccagcaaagtcgactccactccaccccatctgtgacatcagagtgctggacaagtacatt
agagaagcaaaggatgctgcagattcaacgaaacagtgtgcggaagcctgcactctcccg
ggaaactttactcttccaaaaaccaatgtcaactacagagaatgggaaacaaaggactca
ggaacaaaagccgaggaagttcagacaggtctcaagctgctcgcagttgcagtccagaag
gcccagaacatgactgtgaatagcaacatgctgtatctaatagaaaggagctacagtaat
atccgaagcatcacgcagatggtgaggagtttgagaaccccggatatcctaaatcgagaa
cgggaactgcagaccacttttaacacgagaacactgagaaccatttttcacgcatattta
aatttcctacaaggtaaagtcagactgtttttccttgacacagaagcttgcaatctggca
acaagctga

DBGET integrated database retrieval system