KEGG   Rhincodon typus (whale shark): 109911698Help
Entry
109911698         CDS       T06055                                 

Definition
(RefSeq) actin, cytoplasmic type 5 isoform X1
  KO
K05692  actin beta/gamma 1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04145  Phagosome
rtp04210  Apoptosis
rtp04510  Focal adhesion
rtp04520  Adherens junction
rtp04530  Tight junction
rtp04810  Regulation of actin cytoskeleton
rtp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109911698
  09143 Cell growth and death
   04210 Apoptosis
    109911698
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109911698
   04520 Adherens junction
    109911698
   04530 Tight junction
    109911698
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109911698
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109911698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rtp03021]
    109911698
   03019 Messenger RNA biogenesis [BR:rtp03019]
    109911698
   03036 Chromosome and associated proteins [BR:rtp03036]
    109911698
   03029 Mitochondrial biogenesis [BR:rtp03029]
    109911698
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rtp04812]
    109911698
   04147 Exosome [BR:rtp04147]
    109911698
Transcription machinery [BR:rtp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     109911698
Messenger RNA biogenesis [BR:rtp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109911698
Chromosome and associated proteins [BR:rtp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     109911698
    NuA4 complex
     109911698
  Chromatin remodeling factors
   BAF complex
    109911698
   PBAF complex
    109911698
   SWR1 complex
    109911698
Mitochondrial biogenesis [BR:rtp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    109911698
Cytoskeleton proteins [BR:rtp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     109911698
Exosome [BR:rtp04147]
 Exosomal proteins
  Proteins found in most exosomes
   109911698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 109911698
NCBI-ProteinID: XP_020366647
LinkDB All DBs
Position
Unknown
AA seq 390 aa AA seqDB search
MGARGGERYPNMVKMADDEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL
TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPI
YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQ
EMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKC
DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI
LASLSTFQQMWISKQEYDESGPSIVHRKCF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggagcacgaggtggtgaaagatacccaaatatggtcaaaatggcagatgatgagatt
gcagcacttgtcatagacaatggctctggtatgtgcaaggctgggtttgctggagatgac
gcaccccgtgctgtgtttccctccatcgttggtcgtcccagacatcagggtgttatggtt
ggtatgggacagaaggacagctatgtcggtgatgaggctcagagcaagagaggtatcctt
accttgaaataccccatcgagcatggtattgtcaccaactgggatgacatggaaaagatt
tggcatcacacattctacaatgaactccgtgttgctcctgaagaacaccctgtcctcctc
acagaagctcctttgaaccccaaagccaacagagaaaagatgactcagatcatgtttgag
accttcaataccccagccatgtatgttgccatccaggctgtgctgtccctatatgcctct
ggtcgtaccactggtattgttatggactctggtgatggtgtcacccacactgtgcccatt
tatgagggttatgcacttccacatgctattctgcgtctggatctggctggtcgtgatctg
acagactacctcatgaagattctgacagagcgagggtactctttcaccaccacagcagaa
agggaaattgtccgtgacatcaaagaaaaactgtgctacgtagccctggacttcgaacaa
gaaatgggtactgctgcttcctcctcttccctggagaaaagctatgagctgcctgatggt
caggtcatcaccattggcaatgagagattcagatgtcctgaggccctgtttcagccatct
ttcttgggtatggaatcttgtggcatccatgaaactactttcaactctataatgaagtgt
gatgttgatatccgtaaagacctatatgccaacacagtattgtctggtggtaccaccatg
taccctggtattgctgacagaatgcagaaagaaatcacagcccttgcacccagcaccatg
aaaatcaagatcattgctccacctgaacgtaaatattctgtctggattggaggttccatc
ttggcttccctgtcyaccttccagcagatgtggatcagcaagcaggaatatgatgagtct
ggcccatccattgtgcaccgcaaatgcttctaa

DBGET integrated database retrieval system